SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220927835|ref|YP_002504744.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220927835|ref|YP_002504744.1|
Domain Number 1 Region: 31-308
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.81e-51
Family beta-glycanases 0.0000206
Further Details:      
 
Domain Number 2 Region: 342-469
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.66e-31
Family Galactose-binding domain 0.054
Further Details:      
 
Domain Number 3 Region: 572-668
Classification Level Classification E-value
Superfamily E set domains 2.38e-22
Family Cellulosomal scaffoldin protein CipC, module x2.1 0.0013
Further Details:      
 
Domain Number 4 Region: 474-568
Classification Level Classification E-value
Superfamily E set domains 1.54e-16
Family Cellulosomal scaffoldin protein CipC, module x2.1 0.0075
Further Details:      
 
Domain Number 5 Region: 664-731
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000000144
Family Type I dockerin domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|220927835|ref|YP_002504744.1|
Sequence length 732
Comment hypothetical protein Ccel_0379 [Clostridium cellulolyticum H10]
Sequence
MNKLFFIVSLLAALLIFPITASAATDSTHPGFRVEGRFLYDNTGEKVILYGVNKMCIWTD
KDGVPSFSEIAKTGANCVRITWGLDGSAEDLDTVIRNCRAEHMIPIIELHDATGDWSKLP
LLVNYWVRPDIVNVIKKHQEYLLVNIGNEVGQTVTEETFKADYESAVKKMRDAGIHVPLV
IDASSYGQSIDMLQACGPYLISADPDKNLMFSVHMWWPYMWGHSDQEVIDEIAQSVNINL
PLIVGEFGHMWDETENGKIPYKTIMEQCYKNQIGYLPWEWGPGNNPQTFLDMTSDSTFAT
LNDYGKEVMLNNQYSVKNIAKRPASMLSNLPPVLPKEPLPYGNLAYKKPVTASSIESTQN
NESNIVDGDFETRWASQISDPSWICVDLGAKKDINRLIICWEAAYATQYKIQVSDDKSTW
TDVITQYNGTGKTEDIKLSCSGRYLRIYGMQRINYQWPYSIWEIGVYGPESELSASISPA
VAVFDKNPTNAADISVTLDSKSNTFNEVLNGTSVKLVAGQDYVIQDKTTLIIKKEYLLGL
SEGTTKLIFDYSDGVDPVLAIAVGNTTPDGSVQNPIISPSSVTYDRTSATDLRVTISPNG
NTLTSIINGSEPLVPNVDFTISGDTVTIMRSYLATQPSDNLNLTFDFSGNGIDPVLTVTF
LKDTICGDANQDGVIDALDYVILKQHLLGLVTLNNDVINILDLNLDGTTDAIDLSIFKQY
LLGKITYLPVTP
Download sequence
Identical sequences B8I5U7
gi|220927835|ref|YP_002504744.1| 394503.Ccel_0379 WP_012634827.1.84728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]