SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220927872|ref|YP_002504781.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220927872|ref|YP_002504781.1|
Domain Number 1 Region: 777-847
Classification Level Classification E-value
Superfamily Type I dockerin domain 2.16e-16
Family Type I dockerin domain 0.0012
Further Details:      
 
Domain Number 2 Region: 126-251
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.000000000000432
Family Integrin alpha N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|220927872|ref|YP_002504781.1|
Sequence length 848
Comment cellulosome protein dockerin type I [Clostridium cellulolyticum H10]
Sequence
MKYFKKVCITLAAFLISTGFAVGIGTQSVNAASTTIPCRQLEQLDRGIVAVNQGNGKVYV
SWRLLGTEPSNTAFNLYRKTAGGTEVKLNSSPITSCTNYVDNGVDTTKDNTYTVRTVLNG
IENNESEQYTLAANTSVRQYIPIKLKPLPTGYYTMHVNVGDLDGDGKYDYIVKRMNDDRS
PVQVEAYKSDGTFLWRIDLGPNIETYNTAMTSPLVVSDLNSDGKAEVLIKTGESTRFGDG
TLIGDTNNDGITNYCNTSSTSYQVLSGPEFISVIDGMTGKELSRADFIARGQVTDWGDNY
GNRASFIFMTVAYLDGIHPSVVMSRGPGNVMKVEAWDFKDGKLSQRWKWDARNQVLPSGK
NFPDFHAIRAVDVDKDGKDEISWGGSMLNDDGKLLYATELTHGDRFVIGDIDPDRDGLEC
YAIQQNNPSLLGAALYDAGNGTMIKKMYMSAVGDVGRGDCADIDPNYRGMECWSTLENLY
NCKGGVIGSEKSFPFLSIWWDGDLLREFFIGVDSNGFNAAINKWNYTTKTSNRLYSVYQE
GVKSTYAGRPPFYGDIMGDWREEVILETTDNTELRIYTTNIPTNYRIYTLMHNPAYRNSV
DVKGYLSSVYPDYYLGEGMSTPPTPNIYTGDGELIKSLRVNDSNNAADWCIQSNLQVGDT
VYGDRTYKYTKIPQSLTGTEWIRTACDSKSYLDEEANFTAKKDISVYIGLDSRITSIPAW
LSDWTKTGETLSDDSSITFNLYKKDFTSGSVVRLGTNGGSSSFVNYTVIVKPNTAPAFLY
GDVNGDGIVDVLDYSTMRSYLLQITNSMPSAYWQMAGDLNSDGAIDSMDYLYLKMYLLGT
INSLPVSP
Download sequence
Identical sequences B8I5Y4
gi|220927872|ref|YP_002504781.1| 394503.Ccel_0417 WP_012634863.1.84728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]