SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220927882|ref|YP_002504791.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220927882|ref|YP_002504791.1|
Domain Number 1 Region: 9-22,52-379
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.62e-89
Family beta-glycanases 0.00000000114
Further Details:      
 
Domain Number 2 Region: 567-753
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.19e-69
Family Family 28 carbohydrate binding module, CBM28 0.00000409
Further Details:      
 
Domain Number 3 Region: 380-557
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.16e-61
Family Family 17 carbohydrate binding module, CBM17 0.00000402
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|220927882|ref|YP_002504791.1|
Sequence length 930
Comment glycoside hydrolase [Clostridium cellulolyticum H10]
Sequence
MFRNINKRILAFVIVVAMLMSFIPTMAFAAEPDSSHLITSQAEKPSTAGALQILDKNGTK
TLCDKDGNPIQLRGMSTHGLQWYPEIINDNAFAALSNDWGSNVIRIAMYVAEGGYSKDPE
TIKKRVIDGIDLAIANDMYAMLDWHVLTPGDPNADIYKGAMDFFKEISQKYPNNPHIIYE
LANEPSPNDPGVTNDAAGWAKVKSYAEPIIKMLRDSGNKNLVIVGSPNWSQRPDLAADNP
INDNNTIYTVHFYSGTHKPSADSSDRGNVMSNARYALEHGVAVFASEWGTSEASGNNGPY
LKEADEWLEFLNANNISWCNWSLTNKNETSGSFIPFISGKSDATSLDPGDDQVWSPKELS
VSGEYARARIKGIKYEPIDRAEKEEFTTNVWDFNDGTTQGFGINGDSPVKADSITIANEK
NTLKITGLNTSKDLTEGNYWANVRLSADGTSNKPNILGAEKLTMDIITAAPATVSIAAIP
QNSTHGWANPTRAIAVKPADFVKQEDGTYKAVLTITPADSPNFDSIAKDSKDSTMTNIIL
FVGADTNVISLDNITVSGNRTTVEAPVEHAPIGKATLPSIFEDSTRQGWAWDAASGVQSA
LTIKDANGSKAISWEVKYPEVKPVDGWASAPRIMLSNINATRGNNKYLAFDFYLKPTQAS
KGSLSINLAFAPPTLGYWAQASVNFDIPLTKLSKMKKTKDGLYHFQVKYDLDKVNDGKVL
AADTVLRDITIVVADGNSDFAGTMYVDNVRFENDSKSELNNAIAMLVSKGIIKSSDVKKI
NLNKSISRGEFLNWLVKTLDLNAKYSVNFSDVHKKDSYYNPVGIAKALGITNGVGHNKFN
PNKAISREDMLVLTFKALKLVNKNLVKGNADDLKQFTDASKVSRNSVESISTIVKNGFYS
GDAKKLNLKASVSKAETALMLYKIYTSLHK
Download sequence
Identical sequences B8I5Z4
WP_012634873.1.84728 gi|220927882|ref|YP_002504791.1| 394503.Ccel_0428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]