SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220928180|ref|YP_002505089.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220928180|ref|YP_002505089.1|
Domain Number 1 Region: 59-393
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 1.02e-97
Family Cellulases catalytic domain 0.00000000126
Further Details:      
 
Domain Number 2 Region: 403-459
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000000235
Family Type I dockerin domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|220928180|ref|YP_002505089.1|
Sequence length 460
Comment glycoside hydrolase [Clostridium cellulolyticum H10]
Sequence
MIKGSSLKRFKSLVMAAIFSVSIISTAIASSAADQIPFPYDAKYPNGAYSCLADSQSIGN
NLVRSEWEQWKSAHITSNGARGYKRVQRDASTNYDTVSEGLGYGLLLSVYFGEQQLFDDL
YRYVKVFLNSNGLMSWRIDSSGNIMGKDSIGAATDADEDIAVSLVFAHKKWGTSGGFNYQ
TEAKNYINNIYNKMVEPGTYVIKAGDTWGGSNVTNPSYFAPAWYRIFADFTGNSGWINVA
NKCYEIADKARNSNTGLVPDWCTANGTPASGQGFDFYYDAIRYQWRAAIDYSWYGTAKAK
THCDAISNFFKNIGYANIKDGYTISGSQISSNHTATFVSCAAAAAMTGTDTTYAKNIYNE
CVKVKDSGNYTYFGNTLRMMVLLYTTGNFPNLYTYNSQPKPDLKGDVNNDGAIDALDIAA
LKKAILTQTTSNISLTNADMNNDGNIDAIDFAQLKVKLLN
Download sequence
Identical sequences P37699
WP_015924276.1.84728 394503.Ccel_0730 gi|220928180|ref|YP_002505089.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]