SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220928182|ref|YP_002505091.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220928182|ref|YP_002505091.1|
Domain Number 1 Region: 311-810
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 6.32e-138
Family Cellulases catalytic domain 0.0000000000463
Further Details:      
 
Domain Number 2 Region: 35-199
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.6e-28
Family CBM4/9 0.0046
Further Details:      
 
Domain Number 3 Region: 212-309
Classification Level Classification E-value
Superfamily E set domains 3.15e-24
Family E-set domains of sugar-utilizing enzymes 0.00058
Further Details:      
 
Domain Number 4 Region: 822-884
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000017
Family Type I dockerin domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|220928182|ref|YP_002505091.1|
Sequence length 885
Comment glycoside hydrolase [Clostridium cellulolyticum H10]
Sequence
MKKRLVKKVAMLIAIVLVLSSSIGQAFALVGAGDLIRNHTFDNRVGLPWHVVESYPAKAS
FEITSDGKYKITAQKIGEAGKGERWDIQFRHRGLALQQGHTYTVKFTVTASRACKIYPKI
GDQGDPYDEYWNMNQQWNFLELQANTPKTVTQTFTQTKGDKKNVEFAFHLAPDKTTSEAQ
NPASFQPITYTFDEIYIQDPQFAGYTEDPPEPTNVVRLNQVGFYPNADKIATVATSSTTP
INWQLVNSTGAAVLTGKSTVKGADRASGDNVHIIDFSSYTTPGTDYKIVTDVSVTKAGDN
ESMKFNIGDDLFTQMKYDSMKYFYHNRSAIPIQMPYCDQSQWARPAGHTTDILAPDPTKD
YKANYTLDVTGGWYDAGDHGKYVVNGGIATWTVMNAYERALHMGGDTSVAPFKDGSLNIP
ESGNGYPDILDEARYNMKTLLNMQVPAGNELAGMAHHKAHDERWTALAVRPDQDTMKRWL
QPPSTAATLNLAAIAAQSSRLWKQFDSAFATKCLTAAETAWDAAVAHPEIYATMEQGAGG
GAYGDNYVLDDFYWAACELYATTGSDKYLNYIKSSKHYLEMPTELTGGENTGITGAFDWG
CTAGMGTITLALVPTKLPAADVATAKANIQAAADKFISISKAQGYGVPLEEKVISSPFDA
SVVKGFQWGSNSFVINEAIVMSYAYEFSDVNGTKNNKYINGALTAMDYLLGRNPNIQSYI
TGYGDNPLENPHHRFWAYQADNTFPKPPPGCLSGGPNSGLQDPWVKGSGWQPGERPAEKC
FMDNIESWSTNEITINWNAPLVWISAYLDEKGPEIGGSVTPPTNLGDVNGDGNKDALDFA
ALKKALLSQDTSTINVANADINKDGSIDAVDFALLKSFLLGKITL
Download sequence
Identical sequences B8I7V4 Q46002
gi|220928182|ref|YP_002505091.1| 394503.Ccel_0732 WP_015924278.1.84728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]