SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220928184|ref|YP_002505093.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220928184|ref|YP_002505093.1|
Domain Number 1 Region: 36-508
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 2.93e-135
Family Cellulases catalytic domain 0.000000000221
Further Details:      
 
Domain Number 2 Region: 519-670
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 2.04e-29
Family Cellulose-binding domain family III 0.00013
Further Details:      
 
Domain Number 3 Region: 678-736
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000000536
Family Type I dockerin domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|220928184|ref|YP_002505093.1|
Sequence length 737
Comment glycoside hydrolase [Clostridium cellulolyticum H10]
Sequence
MDKMKRVSIYALIVAIVITITQFNFQYKCSSATAAFNYGEALQKSVLFYEAQRSGSLSTS
NIPTRLLWRGDAQLTDGQKEGLDLTGGWVDAGDNIKFGITCAYTTSLLAFGAIEYKDAYE
KSGQMKWLQNQLKWINDYFIKCHPEPNVFWAQVGMTANDHNNWIPIEVTHLMNDRAAIKL
DEQHPGTEVAMGTAAAMAASSIVFRNTDPTYADKLLEHAKQLYEFGDKYRGVFSDVIGKV
DPQGAAAYTSHSGYKDELVWGSIWLYKAMEAKSSGSGSDYLVKAKEYYNGIGKEANQQVH
KYKWAHCWDDQSFGCYILMSQIDPENSLYREDAERWLNWWTVGGTENNADGTKISYTPGG
HAKLDSWGSFRYVSTTALFAFVYSDKLNDTVKKARYHDFAVKQINYILGDNPRKSSYMVG
FGQNYPQHPHHRTAHSSWGQQMDTPTEHRHILYGALVGSVDSTDGFNDSISDYVSNEVAI
DYNAGLTGALARMYSEFGGTPIPDSSFPLPDKPYQPKNEWPVFAKTYYDGTSGTQFSLSV
ENRSAWPARSSNQLKIRYFFTLDAKDISDISIKAPAWVKVTGPTAWDKEKKVYYYTLDLS
GKNIYPGYGWGTGGPELDFTISSASNTWDATNDWSYENWDATYVNGTRKYAPNIPMYEGD
SFKKLAGNEPAGESEEPIILPGDINKDGNIDALDVALLKKYLLGNTLEYDISTADMNSDK
NIDALDFALLKKALLSQ
Download sequence
Identical sequences B8I7V6
WP_015924280.1.84728 394503.Ccel_0734 gi|220928184|ref|YP_002505093.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]