SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220928186|ref|YP_002505095.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220928186|ref|YP_002505095.1|
Domain Number 1 Region: 104-415
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.16e-65
Family beta-glycanases 0.00031
Further Details:      
 
Domain Number 2 Region: 28-94
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000000301
Family Type I dockerin domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|220928186|ref|YP_002505095.1|
Sequence length 424
Comment cellulosome protein dockerin type I [Clostridium cellulolyticum H10]
Sequence
MKKIASLVLTTAMVFLAALPLPASAATTYKLGDVDNDTLISAIDLAAVQQHILGKKTLTG
EAFKAADVNANGEIEALDLAELKQFLLGRITKFSGEGQQQPSGVGITWMDGNTLYPVGVN
YAWYNWSYEFSDNNWNSNFTRIKSDLDTMSSKGINSLRWWVFPDLAYGPLWSGPNEGSLC
TGLPEKWVDHMKETCDYAYSKGIKIYWTITSFDCARADDSVDHDDIIDNPIVLQSFLDNA
MKPILQTLGEHPGVLGWDIINEPEWIIKKEDNGEPNNKGEIFPLAAMRNYIKTTCDFIHQ
YAKQPVSFGSANMKWLGAQYDLWDGLGLDFYDFHWYDWATPYFNPVTTPASSLKLDKPVI
IGEMMPDTQSSSLKMTHKQVLDAIYKNGYAGYMLWSWNDGAFDCKPYVGNNFIDFAAEHP
DVVR
Download sequence
Identical sequences B8I7V8 Q9EYQ3
394503.Ccel_0736 WP_015924282.1.84728 gi|220928186|ref|YP_002505095.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]