SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220928187|ref|YP_002505096.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220928187|ref|YP_002505096.1|
Domain Number 1 Region: 32-460
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 3.71e-148
Family Cellulases catalytic domain 0.0000000000000487
Further Details:      
 
Domain Number 2 Region: 468-526
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000000589
Family Type I dockerin domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|220928187|ref|YP_002505096.1|
Sequence length 526
Comment glycoside hydrolase [Clostridium cellulolyticum H10]
Sequence
MKSKLIKLSAIIISGVMLTTSFVNTGTAFAAGTHDYSTALKDSIIFFDANKCGPQAGENN
VFDWRGACHTTDGSDVGVDLTGGYHDAGDHVKFGLPQGYSAAILGWSLYEFKESFDATGN
TTKMLQQLKYFTDYFLKSHPNSTTFYYQVGEGNADHTYWGAPEEQTGQRPSLYKADPSSP
ASDILSETSAALTLMYLNYKNIDSAYATKCLNAAKELYAMGKANQGVGNGQSFYQATSFG
DDLAWAATWLYTATNDSTYITDAEQFITLGNTMNENKMQDKWTMCWDDMYVPAALRLAQI
TGKQIYKDAIEFNFNYWKTQVTTTPGGLKWLSNWGVLRYAAAESMVMLVYCKQNPDQSLL
DLAKKQVDYILGDNPANMSYIIGYGSNWCIHPHHRAANGYTYANGDNAKPAKHLLTGALV
GGPDQNDKFLDDANQYQYTEVALDYNAGLVGVLAGAIKFFGGTIVNPPVKKGDLNNDTFI
DAIDLALCKNYILTQNGNIDKNNADMNGDGSIDAIDFSLLKKAILG
Download sequence
Identical sequences B8I7V9
gi|220928187|ref|YP_002505096.1| 394503.Ccel_0737 WP_015924283.1.84728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]