SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220928188|ref|YP_002505097.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220928188|ref|YP_002505097.1|
Domain Number 1 Region: 132-424,528-561,599-631
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 7.72e-18
Family Integrin alpha N-terminal domain 0.018
Further Details:      
 
Domain Number 2 Region: 619-675
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000000285
Family Type I dockerin domain 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|220928188|ref|YP_002505097.1|
Sequence length 676
Comment cellulosome protein dockerin type I [Clostridium cellulolyticum H10]
Sequence
MRKKIFMLLLALLQVALLTIPQQLVTAASARQMEYLDRGIVAVKVSNGVFVSWRMLGTDS
TSIAFNLYRDGKKVNTTPITSGTNYVDTTGTASSTYYVCPVKDGVELAKSESTAVWGQNY
LSLPLQIPAGGTTKSGEYYTYSANDCSVGDLDGDGQYEIILKWDPSNAKDNSQSGYTGNV
YLDAYKLNGKFLWRIDLGRNIRAGAHYTQFMVYDLDGDGKAEVACKTADGTKDGIGKVIG
NANADYTNSNGYILSGPEYLTIFNGETGAALTTTDYDPPRGTVSSWGDSYGNRVDRFLAC
IAYLDGVHPSLVMCRGYYTRAVLAAYNWRDGKLTKVWTFDSKDSGNSAYEGQGNHNLSVG
DVDSDGMDEIVYGACAIDHNGRGLYTTKLNHGDAMHLSDMDPGRPGLEVWQCHETGSNAS
SGEYRDARTGQLIWGLAGTSDTGRGLALDIDPRYKGFEMWSSSSDGVYNVNGTKVSTTKP
SMNFGVWWDGDLNRELLDGTKLDKWDYVNSTPMRLLTPADCASNNSTKANPCLSADILGD
WREEVIWRTTDNKYLRIYTTTAVTSNRIYTLMHDPLYRLSIAWQNVAYNQPPHTGFYLGD
GMSQAPTPNIYIAKPASSFLPGDVNNDGSVDALDFAIVKKYLLGQSTELDTGKADMNSDG
DINALDLALLKASLLS
Download sequence
Identical sequences B8I7W0
gi|220928188|ref|YP_002505097.1| 394503.Ccel_0739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]