SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220928202|ref|YP_002505111.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220928202|ref|YP_002505111.1|
Domain Number 1 Region: 38-77,104-530
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 2.28e-121
Family Cellulases catalytic domain 0.0000000432
Further Details:      
 
Domain Number 2 Region: 549-702
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 7.33e-25
Family Cellulose-binding domain family III 0.00049
Further Details:      
 
Domain Number 3 Region: 715-775
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000968
Family Type I dockerin domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|220928202|ref|YP_002505111.1|
Sequence length 778
Comment glycoside hydrolase [Clostridium cellulolyticum H10]
Sequence
MKKGRILKVTRASIMSIVILAMLATSFTVMNVSAAGTEYNYAKLLQYSQYFYDANMCGTG
VGENNQYTWRNDCHIYDAKLPLDSKNTNMADSFIRQNKSVLDPDGDGMVDVSGGFHDAGD
HVKFGMPEAYSGSTLGWGFYEFRDQYVTSGQDSHIKTILRYFNDYFMNSTFLDSTGKAIA
FCYQVGDGDVDHAYWQAPEVDEMFRRGWFATDEMPSTDCVAAAAASLAVNYMNFKDEDPA
YAEKSLKYAKALFQFAERCPTKSVNIDGPKGYYTSSKWQDDYCWAASWLYLATKDDHYLD
ETLKNFDYYAPSCWTHCWNDVWAGTACIIAEINDLIDKNGQVLEDRYKTLTNKSPYEEID
FWSQIAKLVDGWMTGKNVTLSPGGYAFLNQWGSARYNTATQLIALVYDKNHGDTPSKYSQ
WAKSQMDYLLGNNPLNRCYVVGYSDNAVKYPHHRASSGYATAEGTSPQKYVLYGALVGGP
DASDQHKDVTSDYIYNEVTIDYNAAFVGASAGIYRYFGNSSMLVTPNFPPPPAEDDPEDP
SGSAYWVEGFCVDVAQSDGPKATEVTLYVKSNVSKTSKNISVRYYFDSTGMTSLDPNKIE
MRQLYDQTAAETDYAAEFSGPHLYKDKIYYVEVKWPNYVIANSNKKYQFAIGTYAWQNYW
NPTDDWSHQGLKVVEDSWKGTPEKTDNICVYDNGVLVGGIEPDGTTPGGNTPDPTIKLGD
LNNDSAIDALDLTLLKMHLLGLKILTGDALKAADIDASSTVDAIDYVQLKKIILTQAV
Download sequence
Identical sequences Q0PRM9
WP_015924298.1.84728 394503.Ccel_0753 gi|220928202|ref|YP_002505111.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]