SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220928204|ref|YP_002505113.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220928204|ref|YP_002505113.1|
Domain Number 1 Region: 138-572
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 1.47e-117
Family Cellulases catalytic domain 0.00000000000389
Further Details:      
 
Domain Number 2 Region: 42-136
Classification Level Classification E-value
Superfamily E set domains 5.39e-22
Family E-set domains of sugar-utilizing enzymes 0.00012
Further Details:      
 
Domain Number 3 Region: 585-643
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000000255
Family Type I dockerin domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|220928204|ref|YP_002505113.1|
Sequence length 646
Comment glycoside hydrolase [Clostridium cellulolyticum H10]
Sequence
MGLLTSERKGKTKARIACFFISGILATSGCIIPGNFNQNVYAASTSPGDYQQDSRIRLNS
IGYLPEAEKKATIAASSSEFIVVNSSGTAVLTSRTTSAYNTDTSEQVNIADFSSVKTEGS
YTLLVPGIGKSVTFKIDKNIYANPFKTAMLGMYLWRCGTSVSATHNGNVFSHETCHTKDA
YTDYINGQHSIKDGGKGWHDAGDYNKYVVNAGITVGSMFFAWEQFKDQIKEISLTMPESN
NSMPDYLDELKYETDWLLTMQYPDGSGKVSHKLSTKDFGGFVLPEKETTDRFFTPWGSAA
TADFVAMMAMASRAFRPYDAAYADKCIAAAKVSYAFLKANPWNTKPDQSGFTTGAYDTTD
TDDRLWAAAEMWETLGDSSYLADFEASANTFTKKIDVDFDWGNVNNLGMFTYLLSERSGK
NPALYNTIKSALISAADSIVAIADGHGYGRPLGATYYWGCNGTVARQTMILNIANKLSPK
SEYVNTSLDALNFLFGRNYYNRSFVTGLGLNPPMNPHDRRSGGDSLKDPWPGYLVGGGWP
GAKDWTDNQDSYETNEIAINWNGALIYALAASLDTMSDTPDVLSGDINMDGKVDAIDYAL
LKQSILGLANLTGDALRLADVNHDNTVDALDLSVLKQYLLGKITNL
Download sequence
Identical sequences B8I7X6
WP_015924299.1.84728 gi|220928204|ref|YP_002505113.1| 394503.Ccel_0755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]