SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220928236|ref|YP_002505145.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220928236|ref|YP_002505145.1|
Domain Number 1 Region: 50-171
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 1.83e-42
Family Insert subdomain of RNA polymerase alpha subunit 0.0000605
Further Details:      
 
Domain Number 2 Region: 6-50,172-226
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 3.79e-34
Family RNA polymerase alpha subunit dimerisation domain 0.00044
Further Details:      
 
Domain Number 3 Region: 247-310
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 3.14e-24
Family C-terminal domain of RNA polymerase alpha subunit 0.0000555
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|220928236|ref|YP_002505145.1|
Sequence length 315
Comment DNA-directed RNA polymerase subunit alpha [Clostridium cellulolyticum H10]
Sequence
MIEIEKPRIECVSNSDDNTYGKFIVEPLERGYGITLGNSLRRILLSSLPGSAVNSIKIDG
VLHEFSTVPGVVEDVTEIILNIKSLSLLVHGEGSKVIYIDANGEGPITAGDIITDQDVEI
LNPDLHIATLNGDHRFYMEMVISKGRGYVSADKNKQAGQPIGVIPVDSIYTPVKKVNYTV
ENTRVGQITDYDKLTLEVWTDGSINPDEAISLGAKILSEHLNLFVDLSDQAKHTEIMVEK
EETKKEKVLEMTIEELDLSVRSYNCLKRAGINTVEDLTNRTEEDMMKVRNLGRKSLEEVL
QKLQALGLFLAPSEE
Download sequence
Identical sequences B8I808
gi|220928236|ref|YP_002505145.1| 394503.Ccel_0787 WP_015924327.1.84728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]