SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220928324|ref|YP_002505233.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220928324|ref|YP_002505233.1|
Domain Number 1 Region: 42-191
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000000151
Family CBM4/9 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|220928324|ref|YP_002505233.1|
Sequence length 433
Comment carbohydrate-binding, CenC-like protein [Clostridium cellulolyticum H10]
Sequence
MKKKLKSFCTVLSLMFLFQVQPHNIALDGGIYTNEANAVTVISNGNFESGSGNAPTGWST
DAWTTGSSFTWEQSAGRNGSKCISITSNSYNDARWVQTVQLTPNKHYVLSAYVKGENINP
DGTATTGANISVMDEWTVSDSTESTGTFGWKKIYLDFVAPESGSVKLGCRLGFYGSVMSG
KAYFDDIEIIELQRRSGRNVYLNLESSQWSIFTGTNDTRWIGHLDDAYDKYYELVGTKPY
NGTNIGIKSAHIYPGYWAIAGNPINWNQPYVAEEIYKINTDDDWSFGILHEIGHDFDQDG
WNWDAEFWANTKMYYVVEQLGGKVFQNNTYYVGSQLENYYRTHASGSYANTIANRTFKGD
GLTYCFIRIKNVIGWEPFKMTFRYFTSSGANPASKVAKFDLFLDKLTEYSGYDVRSTFLT
GELDTIRNYLAAN
Download sequence
Identical sequences B8I8M0
gi|220928324|ref|YP_002505233.1| 394503.Ccel_0881 WP_015924413.1.84728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]