SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220928359|ref|YP_002505268.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220928359|ref|YP_002505268.1|
Domain Number 1 Region: 56-319
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.72e-21
Family Carboxylesterase 0.00000472
Further Details:      
 
Domain Number 2 Region: 324-391
Classification Level Classification E-value
Superfamily Type I dockerin domain 4.05e-16
Family Type I dockerin domain 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|220928359|ref|YP_002505268.1|
Sequence length 391
Comment cellulosome protein dockerin type I [Clostridium cellulolyticum H10]
Sequence
MFCKKGFKKSLCFILSGILTLSLVAATNTSVSAADASEKVFKPLPYEYKMNSSKQGTIER
LSYRWGNDTKYFNVYLPNGYSQSDTSKKYNVVYLMHGGGEDENLLFGGPGQNKELKVIID
NMIAKGDIKPVIVVTPSFYKGNNDVAGFPQELTTSVIPLVETKYNTYLKSNSAADMKASR
DHRAFGGFSMGSVCTWYTFINCLDYVKYFMPLSGDCWALGSTAGSSKPGETAQYLADVVK
KSGYKAPQDYKLFCATGDGDIAYPNMKPQIEAMKKYTNTFIYSSDVKNGNFYFMVANGGT
HAWNWINQYIYNILPDLFQDIEPIQTLGDLNSDGSVDATDYALLKMHMLNVAPLTGDALK
NADVDRNGQVDSIDFAMIKMYLLGTISSFPV
Download sequence
Identical sequences B8I8Q5
394503.Ccel_0920 WP_015924445.1.84728 gi|220928359|ref|YP_002505268.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]