SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220928368|ref|YP_002505277.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220928368|ref|YP_002505277.1|
Domain Number 1 Region: 41-346
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.03e-114
Family beta-glycanases 0.0000000563
Further Details:      
 
Domain Number 2 Region: 351-421
Classification Level Classification E-value
Superfamily Type I dockerin domain 2.06e-16
Family Type I dockerin domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|220928368|ref|YP_002505277.1|
Sequence length 423
Comment glycoside hydrolase [Clostridium cellulolyticum H10]
Sequence
MRKNSFKSLAVALSVLLTALMVCSSMVSAATPTGKRLKDVQSRVLVGTEFSSGFTNMDST
FFNTATPEFNLVTAENCMKWDALEPSQNSFNWNEADKLMNWAKTNNYKVHGHTFVWHNQA
PGWIQNLSASAMESAMNNHIDKVMGRYKGQIPIWDVANEVFEENGSYRNSFWYRTMGKSF
IEKAFIRARAADPSAKLVYNDYNLEYTGPKSNAAYEMLKDFKSRGIPVDGIGFQMHLDIQ
YAIDYNDFAKNMQRFADLGLEIYITEMDVRVSSNTNSTELQTQASYYKNIIEKCMAQPAV
KAIQFWGFTDKYSWVPGTFSGRDNALLFDKNYNPKPAYYAVQAALATSPTPTVIYGDLDG
SGSVDALDYSLMKQYLLGSITKFPSENGLVAADVNASGTVDALDFAVMKQYLIGLITKFP
AQV
Download sequence
Identical sequences Q0PRN5
WP_015924454.1.84728 gi|220928368|ref|YP_002505277.1| 394503.Ccel_0931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]