SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220928425|ref|YP_002505334.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220928425|ref|YP_002505334.1|
Domain Number 1 Region: 283-605
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.62e-44
Family beta-glycanases 0.012
Further Details:      
 
Domain Number 2 Region: 6-171
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.52e-26
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.029
Further Details:      
 
Domain Number 3 Region: 919-1052
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.69e-17
Family Galactose-binding domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|220928425|ref|YP_002505334.1|
Sequence length 1056
Comment glycoside hydrolase [Clostridium cellulolyticum H10]
Sequence
MDKRSFPLDGDWYVALDEKEIGIKEKWFESTFTEKVKLPGTLDENGIGSLVTGTDTFRLN
RIRKYVGAAWYNRLVVLPDDIVEKHVTLFLERCMWKTELWINGNYAGSQNSLSTPHKYKL
DGMLKAGENLISIKVDNSPIYNLGVMSHGYSEEVQTVWNGIVGRIELDIRDKVYVERANV
YSDMESSKLSTRLLLVNTASKAVEGLISLSVRPQDGENVIIRDSYYFSIGANSSVNVELT
QAYEDKLGLWDEFNQNLYRMDINLECQCEKENEMYSDSSQILFGIRSFKAEGPVFRLNGK
KIFLRGTHDAGNFPITGYPSMEVEDWKRIYAIAKSYGINHFRFHSWCPGEAAFAAADEEG
MILQAELPLFGFTAPPLGQDEPRDSFLREELLRILEEYGNHPSFCMMCMGNELRGDYEML
SEFVEMGRKTDGRHLYSSAANNAAEPGLGIKPNKGDQYYVAHEARINGERVNRRCENVFN
NERPETISDYSETLKGIEVPTISHEVGQWEVYPDFEEIKKYTGVLKAKNFEEFKGSAAAK
QVLNKNKDFVMASGKLAVLLYREEIERSLRTADYGGFQLLDMHDFPGQGTALVGWLDAFW
DSKGLVEPREFRNWCNHSVLLARMEKRVWLNSEVFSAEINFANYSQNDYSQLNIRWELTR
SDGTMYSCGKFNNIFIPQGNLSYIGVAAAELNKVETAEKLILTIVTDGICITNQWDIWVY
PEKLAVEMPEDIYVAESWDDGVSETLGNGGTVLMFTGAVRNSEAMCFTTPFWNTQMFENQ
RKTMGILCNPNHPALLDFPTEYHTNWQWWELLADSKCIGINELPAGFEPIVSAIDHPVRN
NRLGVIFEARVLSGKLLICSLDLNGDLGGLPAARQLKYSILNYIQSERFEPEFYVDESIM
ANMLLKNTASNLKLLTKNIKASNTKYSSKVEYILDTDTSNFWVTMGGQYPYVIDIELTES
TAIKGLTYWPRQDGMTIGLISRYEIYISGDPVQYGKPVASGSFKNTLEKQEIILDWIDDG
FNVTRSKTGKYIRFVAVKGFNNDREAAIGSLDIITV
Download sequence
Identical sequences B8I994
WP_015924511.1.84728 gi|220928425|ref|YP_002505334.1| 394503.Ccel_0992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]