SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220928430|ref|YP_002505339.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220928430|ref|YP_002505339.1|
Domain Number 1 Region: 67-280
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 0.000000000442
Family Cellulases catalytic domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|220928430|ref|YP_002505339.1|
Sequence length 597
Comment hypothetical protein Ccel_0997 [Clostridium cellulolyticum H10]
Sequence
MFENFNLDKIKLSDKYFSVRRETAKKYVNDFDINRLMHTFRKNAGIESLAEPLGGWESEE
CNLRGHFVGHFLSACSKFAFSDNDDCLKTKADNIVKIMAECASENGYLSAFGEEMLDILE
TEEDRGVWAPYYTLHKILQGLVDCYLFLNNKTALSLAVNLAHYIRRRFERLSYWKTDGIL
RCTRVNPVNEFGGIGDVLYSLYEITGDRKIFDLADIFNRDYFIGNLAADRDVLEDLHANT
HLPMVISAIHRFNLTGEYKYKHAAQNFYKYLLGRTFVNGNSSSKATSFKKGEVSEKSEHW
GAHNHLENSLTGGESESCCAHNTEKIVQQLFAWTEDERFLEHLEILKYNAVLNSTSTVTG
LSQYQQPMGTGVKKNFSGLFDTFWCCTGTGIEAMSEIQKNIWFKDKDTLLLNMFIASTVQ
WDEKNVKIVQNTAYPDNTVSVLTVSTSNPVSFTLMLRKSQVKSVKINGKSFNFIADNGYI
YIKRIFNNNDTIEIEIDSSLHLIQLKGSENKAAVMYDRILLAQLGQKPYLDAIDCDNVNQ
RLIKAGSPLLSFKICDNEDGCTEFIPLFRVEDEIYSVYHSFSPLFPSRFQSTEDLLP
Download sequence
Identical sequences B8I999
gi|220928430|ref|YP_002505339.1| 394503.Ccel_0997 WP_015924516.1.84728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]