SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220928444|ref|YP_002505353.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220928444|ref|YP_002505353.1|
Domain Number 1 Region: 7-324
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 6.15e-43
Family alpha-L-arabinanase-like 0.012
Further Details:      
 
Weak hits

Sequence:  gi|220928444|ref|YP_002505353.1|
Domain Number - Region: 397-470
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00204
Family Family 6 carbohydrate binding module, CBM6 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|220928444|ref|YP_002505353.1|
Sequence length 471
Comment glycoside hydrolase [Clostridium cellulolyticum H10]
Sequence
MKKQGFNPYLPSWEYIPDGEPYVFNNRVYVYGSHDRFNGYVYCLNDYVCWSAPVDDLGNW
RYEGVIYKKTDDPLNPDGSMCLYAPDVTVGPDGRYYLYYVLDKLPIVSVAVCDTPAGKYE
FYGYVHYSDGTRLGERADDQPQFDPGVLTEGDRTYLYTGFCAVGDKSRKGAMATVLGPDM
LTIVEEPVFIAPSQPYSKGSGYEGHEFFEAPSIRKNGDTYYFIYSSVVFHELCYATSKHP
TKGFEYKGVIVSNSDLHIDTYKPAQKPMFYGANNHGSIVEINGKWYIFYHRHTNGTNFSR
QACCEQIEILEDGTIPQVEMTSCGCNGGPLEGRGEYAAYLACNLFCEEESLYTDWTASWM
NNQFPKITQDGRDGDEEIGYIANMKASATAGFKYFDCKGIKKVKIKVRGYCQGDFEVKTA
WDGPALGKISVGFTNVWKEYSADIVIPDGVQALYFTYTGQGSASLASFTLE
Download sequence
Identical sequences B8I9B3
WP_015924530.1.84728 gi|220928444|ref|YP_002505353.1| 394503.Ccel_1011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]