SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220928446|ref|YP_002505355.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220928446|ref|YP_002505355.1|
Domain Number 1 Region: 352-625
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.16e-82
Family beta-glycanases 0.000000194
Further Details:      
 
Domain Number 2 Region: 742-1030
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.88e-69
Family beta-Galactosidase, domain 5 0.00016
Further Details:      
 
Domain Number 3 Region: 3-228
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.95e-59
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.00000913
Further Details:      
 
Domain Number 4 Region: 625-734
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 1.87e-23
Family beta-Galactosidase/glucuronidase domain 0.0048
Further Details:      
 
Domain Number 5 Region: 234-346
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 8.35e-20
Family beta-Galactosidase/glucuronidase domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|220928446|ref|YP_002505355.1|
Sequence length 1033
Comment glycoside hydrolase [Clostridium cellulolyticum H10]
Sequence
MSREWENQYITQINRYPMHSPYGAYESVEQAMSCNRWTSKYVKSLSGIWKFKLAQNPQQA
PENFYALNYDVSDWDDIPVPSNWELHGYGKPVYTNIIYPFKREGVGSHYEIEVAEGQVEL
NAPLVPEKNLTGCYRTDFEVPDYFEGKDVFIEFGGVESCFYLWVNGTEIGFSKDSKLDAS
FDITHAVHSGKNELAVKVLQYCDASYLEDQDYWHLSGIYRDVRIYAKNKQRLLDYKVETL
FKDNNFKEAELRVMLQPNNRVRGYGESYVRLSLYNAENELVTAFQSQPYAKCGVYLESKF
TAFPSAFVKNPHLWSAEEPYLYTLVLETVDKNGCVTDIESTKVGFRKVEIGRDGVFYLNG
RRLLVRGVNLHEFCPETGRYVSMEYMRQQILSMKQMNFNAVRTSHYPHASEWYELCDQLG
IYVVDEANLETHGFGGQLSSSAEWTAAYLERATRMVLRDKNHPSIIIWSLGNESGAGANH
AAMYGWIKEYDKTRYVQYESCNPESNITDIICAMYPAKDWVEQKMAEHDDLRPFIMCEYA
YAKSNSNGNFKLYWDLVEKYPRFQGGFIWDFQDKALVKQQENGTSRYVYAGAFNEEVVDP
IEDMCLNGVVLPDLDWKPAAFEIRNCQAPVTIFHDGSTYPEAGDYKIKNNYMFKDLSHLY
LTWELLCDGKIVDRGVIKQYFTAPGQSDILEYALKPEKISGEAFVNITVSLNEDVPYAKK
GHVIYAYQIPLQESVLKMQKVCINHNKLTMHETAGEILILGENTEVRFDKESCIFTKAVF
NGIESFWGGRDNFYRASTGIDEGCRNPGGNYSTDWKDWGLNDLKIKDIKVDTAVSESQIF
IFTNVSYNDDKLIVSTQYRIGSRGMEVDKTVINNCPGETIPRIGFSLMLPEDKQQITWYG
RGPWENYADRKEAALIGCYSSTVPEQYTHYVKPVECGGKEDVRYIIVQDKGGHGLRVSGT
VPFHFDIHDYSVEACDNAMYEHELIKDKYVHLNIDHLHAGLGGDNGWSKNIHTEYRIGKG
CYHYQILIEVVDN
Download sequence
Identical sequences B8I9B5
WP_015924532.1.84728 394503.Ccel_1013 gi|220928446|ref|YP_002505355.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]