SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220928453|ref|YP_002505362.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220928453|ref|YP_002505362.1|
Domain Number 1 Region: 241-724
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 9.52e-105
Family Cellulases catalytic domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|220928453|ref|YP_002505362.1|
Sequence length 759
Comment hypothetical protein Ccel_1020 [Clostridium cellulolyticum H10]
Sequence
MKQKLWYKSPAKEWNEALPIGNGRLGAMVYGCVKNENIQLNEDSIWYGDPIDRNNPDALA
NLAEIRNFLSDGRIKEAEKLAVLSLSGVPESQRPYQTLGNLKLNFEIDESDIRDYSRELD
IENACASVKFVSKGVMYTREYFASAVDQVIVVRLFADAPGKISFTANMRRGRFLDNSGAI
DGKTIGMFASCGSDKGVRFCSMVRAVSEGGKVNTIGENLIVEEADAVTLLISTATSFYHK
EYETQCLKYLDGVEEKTYTELMSNHIEDYSQLYGRVELEIGNAEEHDKIQSLDTAERLER
LESGKPDHQLECLYFSFGRYLLISCSRPGSLPANLQGIWNQDILPAWDSKYTININTEMN
YWPAETCNLSECHFPLFDHIERMRAPGRRTARVMYGCSGFVAHHNTDIWGDTAPQDIYIP
ATYWPMGAAWLSLHLWEHYEFGLDKEFLKDAYPVMKEAAQFFLDFLIEDSKGRLVTSPSV
SPENTYILENGEKGCLCIGPSMDSQILYALFSGCIEASNILDTDISFAEKLIKVRDSLPK
PQIGRYGQIQEWSEDYEEEEPGHRHISHLFGLHPGKQFSTRKTPELATAARKTLERRLAN
GGGHTGWSRAWIINMWARLKDGEKAYENVVDLLKKSTLPNLFDNHPPFQIDGNFGGAAGI
AEMLLQSHEGGIEFLPALPGAWSEGRVKGLVARGNFEVEMEWKDGKLNRATILSRSGGNC
KIFTSLKYRVTSDGKPVDTVQDGQVMSFTTTEGKKYVIE
Download sequence
Identical sequences B8I9C2
WP_015924538.1.84728 394503.Ccel_1020 gi|220928453|ref|YP_002505362.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]