SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220928491|ref|YP_002505400.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220928491|ref|YP_002505400.1|
Domain Number 1 Region: 34-220
Classification Level Classification E-value
Superfamily SGNH hydrolase 1.51e-16
Family YxiM C-terminal domain-like 0.052
Further Details:      
 
Domain Number 2 Region: 230-294
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000000952
Family Type I dockerin domain 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|220928491|ref|YP_002505400.1|
Sequence length 295
Comment cellulosome protein dockerin type I [Clostridium cellulolyticum H10]
Sequence
MKKSNFITFLLLAAFITFCLPTTSFAAGQITGSEVLVIGDSFLAMSHDITKRLEQNAKND
GVLASTDKFRDLSVSGTMLSGGISPNIPQQYQNGVNAGPVKYVIMDGGGNDCIGGSVSNA
VTAARNLFQQMGKSGTVKVFYLFYPDAVGGMAGMLNPNLNTLRPQIQSIVTSSTTPKGYF
LDLRPTFEGKYSSYILSDGIHPTMEGSYAAADAIWAEMKKVGFFGSTTPTPKVGDCNNDG
NIDAIDFSLLKQYLMNPGSTYNSLMDLNADNTINALDFAIMKKYLLGMVNTLPNN
Download sequence
Identical sequences B8I9G0
WP_015924576.1.84728 394503.Ccel_1060 gi|220928491|ref|YP_002505400.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]