SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220928529|ref|YP_002505438.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220928529|ref|YP_002505438.1|
Domain Number 1 Region: 1-400
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.4e-95
Family beta-glycanases 0.000000000000974
Further Details:      
 
Domain Number 2 Region: 410-474
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000000981
Family Type I dockerin domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|220928529|ref|YP_002505438.1|
Sequence length 475
Comment glycoside hydrolase [Clostridium cellulolyticum H10]
Sequence
MKKTTAFLLCFLMIFTALLPMQNANAYDASLIPNLQIPQKNIPNNDGMNFVKGLRLGWNL
GNTFDAFNGTNITNELDYETSWSGIKTTKQMIDAIKQKGFNTVRIPVSWHPHVSGSDYKI
SDVWMNRVQEVVNYCIDNKMYVILNTHHDVDKVKGYFPSSQYMASSKKYITSVWAQIAAR
FANYDEHLIFEGMNEPRLVGHANEWWPELTNSDVVDSINCINQLNQDFVNTVRATGGKNA
SRYLMCPGYVASPDGATNDYFRMPNDISGNNNKIIVSVHAYCPWNFAGLAMADGGTNAWN
INDSKDQSEVTWFMDNIYNKYTSRGIPVIIGECGAVDKNNLKTRVEYMSYYVAQAKARGI
LCILWDNNNFSGTGELFGFFDRRSCQFKFPEIIDGMVKYAFEAKTDPDPVIVYGDYNNDG
NVDALDFAGLKKYIMAADHAYVKNLDVNLDNEVNAFDLAILKKYLLGMVSKLPSN
Download sequence
Identical sequences P17901
394503.Ccel_1099 gi|220928529|ref|YP_002505438.1| WP_015924614.1.84728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]