SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220928656|ref|YP_002505565.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220928656|ref|YP_002505565.1|
Domain Number 1 Region: 16-315
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 1.17e-59
Family alpha-L-arabinanase-like 0.0028
Further Details:      
 
Domain Number 2 Region: 331-459
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.61e-35
Family Family 6 carbohydrate binding module, CBM6 0.0003
Further Details:      
 
Domain Number 3 Region: 465-533
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000000108
Family Type I dockerin domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|220928656|ref|YP_002505565.1|
Sequence length 535
Comment family 6 carbohydrate binding protein [Clostridium cellulolyticum H10]
Sequence
MFKKIKKFSVFMVALLFLSVYSFNLVFADYPIFYQRYTADPSGLEANGRLYLYSSHDVYD
PNKPGYIMNDITCISTDDLKNWTDHGEVFKASGWASLSWAPVVVAKNNKYYMYFGNGAGG
IGVSVSDSPTGPFKDALGKALINGSTPGVNPPSGFWCFDPGAFVDDNGQAYLYFGGNGEG
NTRVIKLNSDMISLNGSASGITAPIFFEDSWIHKYNGKYYYSYSTNFSKGAATIDYMMSD
NPITGFQYKGTVLANPPLNEGNNNHHTIFPFKGDWYIAYHNRALAIANGAASGDARTYQR
SVCIDKLNYNADGTMQKVTITTDGLKQLKYVNPYVTNEAETMAQGSGINTEECTEGGRDV
AFIENGDWIKVRGVDFGTAGAASFDARVASSTSGGNIEIRLDSLTGKLVGTCVVENTSGW
QNWTTKTCSVSGTTGVHDLYLKFTGDSGYLFNLNSWRFNTSGAKTVYGDLDGSGDINAID
FSLMKQYLLGSITKFPIEDGIIAADLDASGTIDAIDYVLLKEYLLGKRTQFPAEL
Download sequence
Identical sequences B8I0L0
gi|220928656|ref|YP_002505565.1| 394503.Ccel_1229 WP_015924734.1.84728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]