SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220928657|ref|YP_002505566.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220928657|ref|YP_002505566.1|
Domain Number 1 Region: 44-331
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.32e-86
Family beta-glycanases 0.0000482
Further Details:      
 
Domain Number 2 Region: 341-468
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.61e-36
Family Family 6 carbohydrate binding module, CBM6 0.00016
Further Details:      
 
Domain Number 3 Region: 476-540
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000000108
Family Type I dockerin domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|220928657|ref|YP_002505566.1|
Sequence length 541
Comment family 6 carbohydrate binding protein [Clostridium cellulolyticum H10]
Sequence
MLSKRKTRKFRIFSTLFVALLCATIITSSFPLTADAAMATGKAKFVGNIWYDGNAPSKYA
DYWNQITPENATKWGPCEPQQGVYNFSQAKAMYNYCKTNKIPFKFHTLIWGSQYPNWLNN
LSGTARKTAIENWYKAAAQNFPDAEYIDVVNEAMPGHAPFPFKNDIGGDNGLYGTGWDWI
VWSFEMARKYFPNSKLLINDYNVLNEWSCLDQYIPVVKILKARNLIDGVGCQSHGLEKTS
AANLKSRLDRLAATGVPIYISELDLDIADDNTQKNKMQELFPVMYEHSAVKGITIWGYLQ
GRTWIPNSHLLRSDGSERPAMTWLKQYMAKVPGEDVPVETRSAFSKLEAESYNDQSGIQN
VTCYEGTEAVGYTENGDYTVYKNIDFSNGATSFQARVSSATTGGNIEIRLDSATGTLIGT
CPVAGTGDWQKFLDAKCTVSGVSGKHDLYLKFTGGSGYLINLNWFMFSNTPVSTDKIGDL
NSDGQIDALDFQVLKKCILGTGTIENTKLADLDANGTIDALDFVLMKQYLLGQITKFPAD
K
Download sequence
Identical sequences B8I0L1
394503.Ccel_1230 gi|220928657|ref|YP_002505566.1| WP_015924735.1.84728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]