SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220928658|ref|YP_002505567.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220928658|ref|YP_002505567.1|
Domain Number 1 Region: 10-308
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 8.71e-68
Family alpha-L-arabinanase-like 0.0015
Further Details:      
 
Domain Number 2 Region: 321-452
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.65e-39
Family Family 6 carbohydrate binding module, CBM6 0.00029
Further Details:      
 
Domain Number 3 Region: 458-524
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000000054
Family Type I dockerin domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|220928658|ref|YP_002505567.1|
Sequence length 524
Comment family 6 carbohydrate binding protein [Clostridium cellulolyticum H10]
Sequence
MKKVSKIAALLLVLTLFIPTVGYADNPIVQTLYTADPAPMIYNDTCYVYTGHDEDTLVND
FFTMNDWRCYSSTDMVNWTDNGSPLSYSSFSWAKGDAWAGQCIQRNGKFYYYVPLTPKTG
GTAIGVAVSDSPTGPFKDPLGKPLVSTGSGDIDPTVYIDDDGQAYLYWGNPNLYYVKLNQ
DMVSYSGSIVKVPLTTASFGTRSKTDRPTTYEEGPWFYKRNSLYYMVFAGGPISEHIGYS
TSTGPTGPWTYRGKIMPTQGSSFTNHPGVADFKGNSYFFYHNGALQGGGGFHRSVCVEQF
KYNADGTFPTINMTTTGSTQIGNLNPFIKTEAETICWESGIETEKCSEGGMNVAFIENGD
YIKVKGVDFGTGAAAFTARVASATDGGNLELRLDSPTGKLVGTCAVTSTGGWQTWVDKTC
TVSGAEGIHDLYLKFTGGSGYLFNFNWWKFIKAGNTSVIGDLNGDKSVDAADYAMMKKYL
LGLIEDFPAENDIEAGDLNKDSVIDALDFAVFKKYLLGTIPSLP
Download sequence
Identical sequences B8I0L2
gi|220928658|ref|YP_002505567.1| 394503.Ccel_1231 WP_015924736.1.84728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]