SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220928659|ref|YP_002505568.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220928659|ref|YP_002505568.1|
Domain Number 1 Region: 292-421
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.93e-41
Family Family 6 carbohydrate binding module, CBM6 0.0002
Further Details:      
 
Domain Number 2 Region: 50-275
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.1e-38
Family Carboxylesterase 0.000000241
Further Details:      
 
Domain Number 3 Region: 426-489
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000000922
Family Type I dockerin domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|220928659|ref|YP_002505568.1|
Sequence length 490
Comment family 6 carbohydrate binding protein [Clostridium cellulolyticum H10]
Sequence
MIKNILTKKTIWGMVAFVFALTLVFTVPDSKVQAAALPTTPPTGYDRVQSNIPHGQVSYI
NYQSKATNSQRRARIYLPPNYSADKKYSVMYLLHGIGGNEDEWYNNGAPNVILDNLIAAG
KIQPFIVVLPNGNATGTGVSDGWTNFTKDLIESLIPYIESNYSVYTDRNHRTVCGLSMGG
GQSFNIGLPNLNLFPYVGAFSPAPNTLPNSQLFPNDGASAKQLLKFLFISYGTTDSLISF
GTGVHNYCDSQSIPNTYFLIQGAGHDWNVWKQSLWNYSQMICEKGFTDYGPVAPVSAFTQ
IEAESFTSQSGVQTETCTEGGLNVGYIENGDYVVYNNVDFGSGATSFQARVASAGNGGNI
EIRLDSITGPLVGTCAVKGTGDWQTWTDAKCTVSGVTGKHDLYLKFTGGSDYLMNFNWFK
FGNATQTLTGDLNGDASEDATDYALLKKYLLGQINDFPVEDDINAGDMNKDGVIDALDFA
VFKKILLGTI
Download sequence
Identical sequences B8I0L3
gi|220928659|ref|YP_002505568.1| 394503.Ccel_1232 WP_015924737.1.84728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]