SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220928663|ref|YP_002505572.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220928663|ref|YP_002505572.1|
Domain Number 1 Region: 649-799
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.86e-39
Family CBM22 0.0025
Further Details:      
 
Domain Number 2 Region: 889-953
Classification Level Classification E-value
Superfamily Type I dockerin domain 5.3e-16
Family Type I dockerin domain 0.00098
Further Details:      
 
Domain Number 3 Region: 801-883
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 0.0000000000000468
Family Crystallins/Ca-binding development proteins 0.001
Further Details:      
 
Domain Number 4 Region: 97-133,163-383
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 0.0000000000023
Family Cellulases catalytic domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|220928663|ref|YP_002505572.1|
Sequence length 955
Comment hypothetical protein Ccel_1236 [Clostridium cellulolyticum H10]
Sequence
MLKTMSILLPCLLIFSLIFSVQIPLSASAANVELLKQFDMEQVKITDTYYVNALNKEVAY
LQAIDPNRLLVGFKKTAGLSTTYSYYGGWENNTLIQGHTMGHYMSALAQAYKNTKSDPTV
NADLKSRIDLIISELQACQNKNGNGYLFATPATQFDVVEGKASGSSWVPWYTMHKIMSGL
LDIYKFGGNQTALTIATNLGNWIYKRVNAWDSATQSRVLGVEYGGMNDCLYELYKLTGNG
NHLTAAHKFDENSLFNTIAAGTNVLPGKHANTTIPKFIGALNRYSTLGTSESSYLKAAQQ
FWAIVLKDHTYVTGGNSEDERFRDAGKLDAYRDNVNNETCNVNNMLKLTKELFKATGDVK
YADYYENALINEIMASQNPETGMATYFKAMGTGYFKVFSSQFNHFWCCTGTGMENFTKLN
DSLYYNNGSDLYVNMYLSSTLNWSEKGLSLTQQANLPLSDKVTFTINSASSSEVKIKFRS
PAWIAAGQNITVKVNGTPINVDKANGYLDVSRVWQTGDTVELTLPTEVRVSRLTDSPNTV
AFTYGPVVLSAGLGTESMTTQSHGVQVLKATKNVTIKETININTAASPSIDNWLANIKNN
LVQTPGKLEFTLKNTDEDNHLVFTPHYQRYKDRYGIYFKLGTYEGKQPTDNLLDNPDIES
GNTTGWTVNGAGTIASSTVQKHSGSYSLLHTGRTGAWNGPIQNITTKVQNGNTYTCSGWV
ILDNTASAPITMTIRKTDDNGTSYVNIATATGSNSSWVQLSGNYTLNVTGALTDLSIYFE
GPDSGTNFYVDDALVKVYGKTTFYQNTSFGGTAVSLNPGSYTTAQLTAAGISDNWASSIK
IPEGYTVEIYDDDNFTGTKWSFSADNSNFIEAGCNDKMSSVKIFPTLSQVKYGDINRDGT
VDTIDFALLKQFLLGAQVTIDSVAADLDGDESVTAMDFAVFKKYLLGQITELPAF
Download sequence
Identical sequences Q0PRN3
394503.Ccel_1236 gi|220928663|ref|YP_002505572.1| WP_015924741.1.84728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]