SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220928664|ref|YP_002505573.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220928664|ref|YP_002505573.1|
Domain Number 1 Region: 28-307
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.22e-91
Family Amylase, catalytic domain 0.0000000723
Further Details:      
 
Domain Number 2 Region: 399-530
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.7e-39
Family Family 6 carbohydrate binding module, CBM6 0.00017
Further Details:      
 
Domain Number 3 Region: 301-395
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 7.2e-25
Family alpha-Amylases, C-terminal beta-sheet domain 0.00057
Further Details:      
 
Domain Number 4 Region: 537-600
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000000314
Family Type I dockerin domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|220928664|ref|YP_002505573.1|
Sequence length 604
Comment family 6 carbohydrate binding protein [Clostridium cellulolyticum H10]
Sequence
MKKVRTVSTIIFLGLMITVIMVLNTGAWDNGLAKTPPMGWNSWNIFHGDINETKIKQIAD
TMVSSGMKEAGYVYLNLDDNWMANPARDSNGNLRADPTRFPSGIRALADYVHAKGLKLGI
YGCRGTMTCMNIPQSGSKGYEDKDAKTFASWGIDYLKYDNCNIPNGSDMKTDYQKMQTAL
ANCGRPIVFSICAWGYQSWMPATGNLWRTTGDIADKWDNGNEWFKGIINAIDGNAQYTSS
AAPGAWNDPDMLEIGNGGCTTEEYRTQMSMWSMMASPLIAGNDIRTMSQTTKDILLNKEV
IAIDQDPAGVQGKRVKSANGLEIWVKPLGTNGTTKAVALLNRNSATSNITVNWSDIGVSG
SVTVRDLWAKSDKGSFTGSYTASVPSHGTVLIKISTEPPAPVDATKQIEAESYSNQSGIQ
TETCSEGGEDVGFIENGDYTVYSNVDFGDGVGGFQARVASATSGGNIEIRLDSPAGTLIG
TCPVAGTGDWQTYTDVKCTVSGATGKHDVYLVFKGDSGYLFNLNWFTFTPGSVNTGTLGD
LNSDGQVDAIDLQLLKKYILGLGAIENTKLADLDANGDINAIDFSLLKQFLLGIRTSFPG
QGAA
Download sequence
Identical sequences B8I0L8
394503.Ccel_1237 WP_015924742.1.84728 gi|220928664|ref|YP_002505573.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]