SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220928667|ref|YP_002505576.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220928667|ref|YP_002505576.1|
Domain Number 1 Region: 549-779
Classification Level Classification E-value
Superfamily SGNH hydrolase 3.11e-49
Family Putative acetylxylan esterase-like 0.00034
Further Details:      
 
Domain Number 2 Region: 336-462
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.21e-34
Family Family 6 carbohydrate binding module, CBM6 0.00024
Further Details:      
 
Domain Number 3 Region: 19-285
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 4.45e-25
Family alpha-L-arabinanase-like 0.01
Further Details:      
 
Domain Number 4 Region: 473-539
Classification Level Classification E-value
Superfamily Type I dockerin domain 4.51e-17
Family Type I dockerin domain 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|220928667|ref|YP_002505576.1|
Sequence length 780
Comment family 6 carbohydrate binding protein [Clostridium cellulolyticum H10]
Sequence
MKHLYKKGFSIIFCLFLILASVSAVNAAANPNPSWNVDERVIFHNQCSPYDYYAAKDPTI
VYYNGKYLVYYTGANKSGGWQMCFTSASTISGLKTAPRTYMSKIGESYFCAPELFYYEPQ
KLWYLVYQDGTHGAAYATTTTPDDPNSWSGPKSFGISGNMGWDYYIICDDQYAYMYNTPS
DGSGKLYMRKTTLANFPNKGWSTPTVACSNVFEGAAVYKSLADGQYYMLIEAMIDGRSYE
LFTSSSAGGPWTLVNNKWATRSNLTKYNADKWTTNVSHGELIRAGYNQKLEINDINKVDF
LIQGTTNMNAEYQQIIWDLGLIRNYEGSPDTPVTPRTAFEKIEAESWNDQSGIQNVTCDE
GTEAVGYTENGDYSVYKSIDFGSGATSFQARVSSATSGGKIEIRLDSATGTLVGTCTVSG
TGSWQTFADVNCTVSGVSGKHDLYLKYIGDSGYLINLNWFKFGTGSTDPVDPTLKLGDVN
SDGQVDAIDLQLVKKYLLGSGTIENTKAADVDANGEVNAIDFSLIKQYLLGIIIEFPGEG
TTEPTTPKFHCFLLLGQSNMAGYAAAQASDKVEDPRVLVLGYDNNAALGRVTDKWDVACP
PLHASWLDAVGPGDWFGKTMIQKVPSGDTIGLIPCAISGEKIETFMKSGGTKYNWIINRA
KLAQEKGGVIDGIIFHQGESNSGDPSWPGKVKTLVEDLRKDLNLGNVPFIAGELLYSGPC
AGHNTLVNQLPSLITNSYVVSADGLVVDPADTQYRLHFGHDPSVTLGKRYAEKMIQALKW
Download sequence
Identical sequences B8I0M1
gi|220928667|ref|YP_002505576.1| 394503.Ccel_1240 WP_015924745.1.84728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]