SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220928668|ref|YP_002505577.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220928668|ref|YP_002505577.1|
Domain Number 1 Region: 309-798
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 1.59e-71
Family Trehalase-like 0.024
Further Details:      
 
Domain Number 2 Region: 963-1094
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.02e-38
Family Family 6 carbohydrate binding module, CBM6 0.00043
Further Details:      
 
Domain Number 3 Region: 820-960
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.28e-25
Family Fucose binding lectin 0.085
Further Details:      
 
Domain Number 4 Region: 1100-1163
Classification Level Classification E-value
Superfamily Type I dockerin domain 3.53e-16
Family Type I dockerin domain 0.00087
Further Details:      
 
Weak hits

Sequence:  gi|220928668|ref|YP_002505577.1|
Domain Number - Region: 130-242
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.0232
Family Glycosyltransferase family 36 N-terminal domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|220928668|ref|YP_002505577.1|
Sequence length 1164
Comment family 6 carbohydrate binding protein [Clostridium cellulolyticum H10]
Sequence
MNINKKIIRKIGATVLAGVLIVSGNLPFNGYKSLAASQDTVEAGGIATQDNDLKLFYNSM
AGNNFSGNPYDLNESFYKALPLGNGRIGAMVYGNYPDERIDLNEATFWSSGPGNNNRAGA
ANFLKTAQDQLFAGQYKTGSATIANNMIGGGEAKYQSIGDLKLSFGHSSVSNYSRQLDMN
TGVVSSDYTYNGKKYHRESFVSYPDQVMVTKITCSSPGSISLTAGYESSLTGQYTVSTSG
NDTLVMNGHGDSDNGISYAVWFSTRSKIINSNGSVSANNNQISVSNADSVVILTSIRTNF
VNYKTCNGDEKGKATTDIANASAKSYDTLYNNHVTDYQNLFKRVDVDLGGSGSENGKPMG
QRISEFGTTNDPKLAKVLFQYGRYLMISASRDSQPMNLQGIWNKFRNPAWGCKMTTNINY
EMNYWPAFTTNLAECFEPFVKKAKELQAPGNETARVHYNISNGWVLHHNTDLWNRTAPID
GDWGFWPTGAGWVSNMLFDAYSFNQDTVYLNEIYPVIKGAADFLQTLMQSKSINGQNYQV
ICPSTSPELTPPGTSGGQGAYNSYGVTMDNGISRELFKDVIQASKILNIDSSFRSTLASK
VSQIKPNTVGSWGQLQEWAYDWDSQSEKNRHISFAYDLFPGLEINKRNTPAIASAVSKSL
NTRGDVGTGWSEAWKLNCWARLEDGAHSYNLVKLLITPVSKDGRLYDNLWDAHPPFQIDG
NFGFTSGIAEMLLQSHNNEIQLLPALPSQWSTGHANGLCARGNFTVTKMNWANGVLTDAT
IKSNSGNVCNVRYGNKTISFPTKKGYTYQLNGSLQLVEPGTTLTNVALNKTATASGTNLG
EEAGKAIDGSTTSKWCHDNGMRGEWLQVDLGAKYDISRWVVKHAGVAETIRFNTRDFTLQ
KSDDGTNWADVDEVYGNQQNITDRNVPTFNARYVRLYINTATQDNSGGARISELELWGKP
SVDIPKSAFSQIEAEEFNSQYGVQAETCSEGGQDVAFIENEDFAAYSNVDFGEGAKSFQA
RVSSATSGGNIEIRLDSIDGPLVGTCPVTGTGDWQNWSDVTCNVSGASGKHDLYLKFTGD
SGYLFNLNWFKFSNAPIVTGKPGDINNDGQIDAIDLLLLKKYLLGLETIENTKLADLDAN
GEINAIDFSLLKQYLLGNISVFPG
Download sequence
Identical sequences B8I0M2
WP_015924746.1.84728 gi|220928668|ref|YP_002505577.1| 394503.Ccel_1241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]