SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220928669|ref|YP_002505578.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220928669|ref|YP_002505578.1|
Domain Number 1 Region: 47-331
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.52e-52
Family beta-glycanases 0.000000388
Further Details:      
 
Domain Number 2 Region: 429-558
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.79e-37
Family Family 6 carbohydrate binding module, CBM6 0.00013
Further Details:      
 
Domain Number 3 Region: 328-419
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 4.05e-24
Family Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 0.0028
Further Details:      
 
Domain Number 4 Region: 564-627
Classification Level Classification E-value
Superfamily Type I dockerin domain 6.57e-16
Family Type I dockerin domain 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|220928669|ref|YP_002505578.1|
Sequence length 629
Comment family 6 carbohydrate binding protein [Clostridium cellulolyticum H10]
Sequence
MITSFKKMFSVFVVCLIVFSLVFTVPVTEVSAASDVTVNLSAEKQEMRGFGGMVHTGWQS
DLTAAQRETAFGNGNGQLGFTILRIHVDENSNNWSRGIATAKSAIAHGGIVFASPWNPPT
SMQEKFTRNGTANQTRLKYDQYAAYAQHLNNFVKYMKDNGAPLYAISVQNEPDYAHTWTW
WTPQEMLNFMKNNAGSITGAKVIAPESFQYLKNISDPILNDSTALANMDILGAHFYGTSV
SNMPYPLFQQKGAGKELWMTEVYVPNSDADSADRFPEALDVAYNMHNGIVEGNFQAYVWW
YIRRSYGPMKEDGTMSKRGAMMAQYSKFVRPGYVRVDATKNPNTNVYISAYKGDGKAVIV
AINKGTSAVSQKFNLQGASSVAKVSSWVTDGSRNVAAATSYTGTSFTAQLPAQSVTTFVA
DLGTITPVEKDAFSKLEGESYDDQSGTQNGSCNEGGECLGYIENGDYAVYKNVNFGEGAQ
SFQARVSSATTGGNIEIRLDSPNGTLVGTCPVAGTGDWQNWADVTSNVSGVSGKHDLYLT
FTGDSGYLFNINWFKFDKAPIVTGKTGDINNDGQIDALDLLLLKKYILGLDTIENAKLAD
LDANGELNAIDFALLKQYLLGLITVLPTV
Download sequence
Identical sequences B8I0M3
WP_015924747.1.84728 gi|220928669|ref|YP_002505578.1| 394503.Ccel_1242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]