SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220928672|ref|YP_002505581.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220928672|ref|YP_002505581.1|
Domain Number 1 Region: 19-339
Classification Level Classification E-value
Superfamily Family 10 polysaccharide lyase 8.24e-89
Family Family 10 polysaccharide lyase 0.00000176
Further Details:      
 
Domain Number 2 Region: 493-548
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000000222
Family Type I dockerin domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|220928672|ref|YP_002505581.1|
Sequence length 552
Comment pectate lyase [Clostridium cellulolyticum H10]
Sequence
MITKTRSQIPKVLLITMLVSVFSLILLFPKHAFASTPDWKSVLKNSDSWFGSSEGIALAD
SIVKYQLADGGWRKDMTTSTSGSWGKSTIDNDTTTSQIKVLAKTYNQTKNTKYLTSCQKG
IDLLLNGQYSNGGWPQVFNDAGTYHAHITYNDNAMIHVMNLLTDVSKKSGDYTFIDSTRA
SKAGGAVQKGIQCILNTQIIVNGIKTAWCQQHDELTLKPTSGRAYELPSICTSESVGIVN
YLKGISNPSTEITNAINSAVNWFAQVKILGIKVVDTGDDRIVVSDSQAPPIWARFYEMGT
NRAMFVDRDGSIHYQMSEISQERRDGYDWYGDWPKNLVKDTVIPTPIPDGQYIKSLIVSD
TDNAADWSIQTNLQVGDTIYGDRTFKVVQIPQSLAGAEWIRTACDSKLYTSDEASFTAKS
DITVYAALDTRVTSIPAWFGSWTKTDETLSTDNAVTYNIYKKDFTTGSSVVLGTNGASSS
VVNYTVMVKPKSIILKGDVNGDGAVDALDFALVKRYLLNGVTDGMNLQAADMNNDNSVNA
IDLALIRGDILY
Download sequence
Identical sequences B8I0M6
gi|220928672|ref|YP_002505581.1| WP_015924750.1.84728 394503.Ccel_1245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]