SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220928676|ref|YP_002505585.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220928676|ref|YP_002505585.1|
Domain Number 1 Region: 27-458
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 2.17e-141
Family Cellulases catalytic domain 0.000000000891
Further Details:      
 
Domain Number 2 Region: 475-621
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 6.8e-31
Family Cellulose-binding domain family III 0.0000887
Further Details:      
 
Domain Number 3 Region: 626-685
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000000366
Family Type I dockerin domain 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|220928676|ref|YP_002505585.1|
Sequence length 686
Comment glycoside hydrolase [Clostridium cellulolyticum H10]
Sequence
MKKVSVLVVLAVLLVSIIPSAVSAEENNFNYVDAFAKSILFYEANWCGPDAGNNRIKWRG
PCHCDDGKDVGLDLTGGFHDCGDHVKFGLPQCASASTLAWAYYEFEDVFIDKGQDGYMLN
ILKHFCDYFMKCFPNKTTFYYQVGDGDVDHQYWGPPELQTYDRPAYYVATPSNPGSDVAG
DAAAALALMYLNYKDIDSTYAEKCLTYAKDLYDFGMTYRGNSKGQSYYLPRTYLDELMWG
SIWLYVATNDNKYMDNVEKLMVEKGITGGNSFNDNWTQCWDYVLTGVFTKLATLSTNPLY
KSIADDHIDYWQNRLKTTPAGLKYLDSWGVCKYPAAESMVQLVYYKYFGNEKCLDFAKGQ
IDYILGDNPNNMSYVVGFGDNYPKYPHHRAASGVLEGPPADEKKELPERHILYGALVGGA
DMNDEYHDNVNEYVYSETGLDYNAGLVGAMAGMSKYFGKDQLPEPTPGIEGEPTQYYSEA
KLYKSNTEGVTVDLNLYNIVTAPPQYEKDLSCKFFVDLSEFAAEGINPSKFTTKVYYSPA
DAQISGIQPYDKEKNIYYVEITFPNSQLYARTYVQFCIYNYESKLWDSKNDLSTAGLTDE
YAKIENIPIYKNGVKVYGNDPAGSTTILYGDLNNDKEINAIDFALLKKYLLNGDAEGIIL
NNADINKDGAVNALDFANLKLYLLGK
Download sequence
Identical sequences B8I0N0
WP_015924754.1.84728 394503.Ccel_1249 gi|220928676|ref|YP_002505585.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]