SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220928685|ref|YP_002505594.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220928685|ref|YP_002505594.1|
Domain Number 1 Region: 5-375
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 2.65e-103
Family Cellulases catalytic domain 0.00000000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|220928685|ref|YP_002505594.1|
Sequence length 376
Comment glycoside hydrolase [Clostridium cellulolyticum H10]
Sequence
MSKGAYFTKQYPNLFAELGISDEQINKKVNDTFNTMFFDPEEKIYFEIGKDMGYMMDTGN
NDARTEGMSYGMMMTLQMDRKDIFDRLWLFSKTYMYQNEGKYQGYFAWSVSTDGKKNAEG
PAPDGEEYFAMALFFAGKRWGDGKPPFDYSIQARDILKHCIHQSEIVEGGEPMWDSTNHY
IKFVPETPFSDPSYHLPHFYELFALLANEEDKDFWKKAAEASRNYLHISCDRDTGMASEY
AEFDGTPKKLFRDFQFYSDSYRVAMNIGLDAAWFSKDESLGDIVDKLQSFFSENTVLGEY
KAYTVKGEPFDAPAMHPVAIIATNAAGSLAAKGKYRDQWVKDFWELPLRKGVHRYYDNCL
YFFSLLMLAGKYKIYI
Download sequence
Identical sequences B8I0N9
gi|220928685|ref|YP_002505594.1| 394503.Ccel_1258 WP_015924763.1.84728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]