SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220928689|ref|YP_002505598.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220928689|ref|YP_002505598.1|
Domain Number 1 Region: 94-199,403-588
Classification Level Classification E-value
Superfamily SGNH hydrolase 1.19e-75
Family Putative acetylxylan esterase-like 0.0096
Further Details:      
 
Domain Number 2 Region: 235-365
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.45e-25
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|220928689|ref|YP_002505598.1|
Sequence length 635
Comment hypothetical protein Ccel_1262 [Clostridium cellulolyticum H10]
Sequence
MGIILNSNRPKIRLPRIISDGMVLQRNTDVKIWGWASPGEAVTVRFIGKAYHAFADDSGE
WFVRLEQAKAGGPYDMYIETEESLEKITIKNILMGDVWLCSGQSNMEMKMDSVKDTYPDE
IVHSCNDYIRHFLVPVKYDFEKPQTDLEAGIWEAANPESILDFTATGYFFALKLFEKYNI
PIGLINASLGGSPAEAWLSENALREFPEHYESAKQLSNRDYLDKVLREDQESAEAWYTAL
NQNDEGLKSNDIPFHDTEYDAPFWQNIKVPSYWEDEGVGNFNGVVWFRKEIDIPSTLADK
PARLVLGNIVDEDTAYINGIEVGTTPNQYITRKYSIQEGLLKEGKNTIVLRVVNTAGKGG
FYKDKPYQLEIGDNIIELSGEWQYMIGAKSSPMPAPAFVQWRPLGLYNGMIAPVTSYSIK
GFIWYQGESNTKNPGEYENLLKALIADWRQKWNMGNLPFLYVQLPNFMEASEIPMESSWA
ELREAQRRTLSVPCTGMAVAIDLGEWNDIHPVNKKDVGFRLALAAMKTAYRDKTIVAYGP
MYQSGKIDGNRIILSFTDTGSGLTVKNGDRPEAFAIAGADRTFVRADAEIIGDSVAVWSE
KVSHPVYVKYAWADNPADANLYNLEGLPASPFTTE
Download sequence
Identical sequences B8I0P3
394503.Ccel_1262 gi|220928689|ref|YP_002505598.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]