SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220928864|ref|YP_002505773.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220928864|ref|YP_002505773.1|
Domain Number 1 Region: 270-784
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 2.08e-99
Family Glycosyltransferase family 36 C-terminal domain 0.0000000417
Further Details:      
 
Domain Number 2 Region: 1-266
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.95e-73
Family Glycosyltransferase family 36 N-terminal domain 0.000001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|220928864|ref|YP_002505773.1|
Sequence length 784
Comment glycosyltransferase [Clostridium cellulolyticum H10]
Sequence
MRFGYFDRKNREYVVTRPDTPTPWINYIGSGNYGGIVSNTGGGYSFHKDPQNRRVTRYRY
NNIPMDRPGRYVYIRNKDTGEYWNPGYQPVQKKLDGYSCRHGLGYSVLTGEYKGVIGEVT
YFVPDDKNFELWFVKVSNTRSIQQNLQIFAYSEFCFWDAIMDQQNVDWVQQINQGRFDDG
IITYHPHHVSDNAAFFATGEKVSSFDTNLETFIGRYRSEGNPIAVEQGACSNSISYRTNG
VGAFCIDCDLGPNEERELVFVLGFAEEKSEIRKDIKEYLLPENAKAAFSRLQASWLDFTS
KLSVETPDEDMNLFVNIWNQYQCKTTLNWSRFVSLYQLGLGRGMGIRDSAQDTLGVMHTI
PAEAKEVIIKLLKCQYTDGRAYHLFFPLTGEGGQGDAPVKKFDWYSDDHLWLILAVNAYI
KETGDFEFLNMEVPYNDKITSQTVMRHLDMALEFTNNNRGPHNIALAGRADWNDTLNLDT
GKGVAESVFTSMLYCRALIEMIEILDYLKNTDMIKKYSDMYEDMKNAINDTCWDGEWYKR
AFDDNSQPLGSKENKFGKIFINSQSWAVLSKVAENGRANESMESVEKYLNSKYGVVTMYP
AYTEYDTTKGGVTTFPPGTKENGGIFLHTNPWVMISEVMLGHGDKAFMYYNQILPGKRND
DAELYEVEPYVYCQNILGKEHPQFGIGRNSWLSGTAAWNMVASSQYILGIRANYDSLTVD
PCIPSSWKGFKATRVFRGATYYIEVQNPNRVCAGVEKIIVDGVETEKIPVFEAGTEHNVV
VVMK
Download sequence
Identical sequences B8I1W7
WP_015924937.1.84728 394503.Ccel_1439 gi|220928864|ref|YP_002505773.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]