SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220928968|ref|YP_002505877.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220928968|ref|YP_002505877.1|
Domain Number 1 Region: 536-701
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 9.17e-42
Family Histidine kinase 0.0041
Further Details:      
 
Domain Number 2 Region: 468-547
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000000145
Family Homodimeric domain of signal transducing histidine kinase 0.0014
Further Details:      
 
Domain Number 3 Region: 49-195
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000453
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|220928968|ref|YP_002505877.1|
Sequence length 708
Comment histidine kinase [Clostridium cellulolyticum H10]
Sequence
MNFKYNFVLIVLAVCSLLIFSGCTNESDKVITAPKSIGGVLDLTDWDFEKDGIIPLDGEW
EFYWEEMLEWSDFQSHIPVKTGNIYVPGSWNKYKIDGKKLSSNGYATYRLTVVTSSTSNT
LALKIPRIFTAYSLWSNDGLLVSSGKIAKNKEGMVPQYYPKIVTLNPNGTTFQLIVQVSN
FSHRSGGILESIKLGTERQIIMARENKLALELLLFGCLMIMGIYHIVLFSFRKKNLSPLY
FGVYCVLIAIRTLFVGEIFFIQLFPDFNWELQHKIQTLTFYAGVPIFATFVNSVFTDEFP
KSALKFSQAAGALFCLLVLLTPARIFTYFNPLYQVITLIVIIFVVRSFILACARKRSGAL
IFTIGGLFFILTALNDIVFLSIPFNDNNLPYLRYIIVTGNLSSLGLIILVFSQSIMLAAN
FSKAFSQVEVMSEQLIIADKQKNTLLSSLEDKVRERTMDLEESNRQLESVCKNLSLMERT
RKDLLTSISHDLRTPMTLIRGYTEAFLDDMVNNKEDQKKYLKLIHNKIIGLSNLTDNIFE
LSQLESREIKLELQKVSMADIMAKLDSKYRYDVENAGLNYIVEIPDEALDYIYIDINQMD
RVFSNLIYNAIKHTPKGSITVTSSLSGDYVLYCISDTGKGISHDDIPYVFDRFYTGSKSR
NSSSSGGGLGLAIVKEIVEYHGGSVRVKSTPNEGSSFIVTISRSLELL
Download sequence
Identical sequences B8I271
gi|220928968|ref|YP_002505877.1| WP_015925037.1.84728 394503.Ccel_1545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]