SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220928973|ref|YP_002505882.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220928973|ref|YP_002505882.1|
Domain Number 1 Region: 34-289,364-394
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.75e-96
Family Type II chitinase 0.000000584
Further Details:      
 
Domain Number 2 Region: 290-363
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.0000000000000155
Family Chitinase insertion domain 0.0003
Further Details:      
 
Domain Number 3 Region: 414-478
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000000177
Family Type I dockerin domain 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|220928973|ref|YP_002505882.1|
Sequence length 482
Comment glycoside hydrolase [Clostridium cellulolyticum H10]
Sequence
MSRLTSIFLIISLMLSCTGISSAVANDTVNSMEQTYRNVAYFTSWGGYQRAVEVGDINPS
LLTHINFAFANLSADGTITVGDPWIDTQKPYGDDTWETELRGHFGQLIRLKQQHPHIKTL
ISVGGWTWSENFSDVAASDSLRKACAKSAVDFVVKYDFDGVDLDWEFPVQGGKNIPHRVN
DGDNYILLLKEIRTALDLQEKIDGKDYLLSIAGASYSKFLDDCKIAEMMHYLDYINVMTY
NYHGTWDDITNHNTPLYTNSDDLCVSASIENYISAGVEPADINLGLAFSGKGWINVTDPN
GSGLYKSGTAPTSAGYGSGTFEAAVFDFGDITENYINKNNYVRYWDDIAKVPYLYNGSTF
ITYEDEESIGCKADYIKKMGLGGAMFWEFSYDKNLVLQNVIAKKLNINKIPEVVFYYGDV
NEDGIIDSIDFALLKSFLLGKGALQNMDIADVNNDGNIDALDLTCLKMILLEKNTPKPIE
LK
Download sequence
Identical sequences B8I276
gi|220928973|ref|YP_002505882.1| 394503.Ccel_1550 WP_015925042.1.84728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]