SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220928974|ref|YP_002505883.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220928974|ref|YP_002505883.1|
Domain Number 1 Region: 176-500
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.58e-57
Family beta-glycanases 0.0003
Further Details:      
 
Domain Number 2 Region: 520-582
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000000373
Family Type I dockerin domain 0.0014
Further Details:      
 
Domain Number 3 Region: 34-160
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000425
Family Family 6 carbohydrate binding module, CBM6 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|220928974|ref|YP_002505883.1|
Sequence length 583
Comment glycoside hydrolase [Clostridium cellulolyticum H10]
Sequence
MKKIFGRVLSLLTGVALGCTILTTVPAPVQAAYSLPVNVEAEACSLGNGATVATNVYGTE
YPGYSGDGFVWASNSGTITLEVTVPTNAMYELSTRCWMYLGNQGDSRLQVVSINGVPQGN
FYIPNKGGWMDYSFGFFYLEAGTTKIEIGSSGSWGFILYDKISFDYADMPDLNIEPTLCD
PKATLETKSLMKYLTSVYGNHVISGQQEIYGSGNDGDYELEFNYIYDKTGKYPAIRGFDL
MNYNPLYGWEDGTTERMIQWVKEKGGIATACWHINVPADFTSYKLGDKLDWTKCTYKPTS
SFNTANCLDKTTKEYAYLMLAIDEMAKQLLILQDAKVPVLLRPFHEAEGNNNTDGSGAWF
WWGSAGSDVYKELWKLLYTTLTEKYGIHNVIWEVNLYTYANSLEWYPGDKYVDIVAYDKY
EGSPYTWKTSAASTAFLTLVNDTNDTKMVAMTENDVIPDIQNIVNEGAWWLYFCPWYGDF
ITSSRYNDPVLLNTIYNSEYVVTLDELPKDIYGSAPSDEVAGDLNSDGNFDAIDFGLLKS
YLLLNTPINLTTADVDGNGQVNALDFSYMKQKLLGKIDKFPIE
Download sequence
Identical sequences B8I277
gi|220928974|ref|YP_002505883.1| 394503.Ccel_1551 WP_015925043.1.84728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]