SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220929058|ref|YP_002505967.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220929058|ref|YP_002505967.1|
Domain Number 1 Region: 1-75
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 0.000000000222
Family N-utilization substance G protein NusG, N-terminal domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|220929058|ref|YP_002505967.1|
Sequence length 85
Comment NusG antitermination factor [Clostridium cellulolyticum H10]
Sequence
MNNWFVFRVQIGEEYKACEFLNKLYDKEESVEFVPQVEVVTKNSQSIRKELTPTFPGYVF
TGSILKEKTFVDLAYLYARFSKCVF
Download sequence
Identical sequences B8I2J4
WP_015925103.1.84728 394503.Ccel_1636 gi|220929058|ref|YP_002505967.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]