SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220929070|ref|YP_002505979.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220929070|ref|YP_002505979.1|
Domain Number 1 Region: 51-542
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 1.87e-121
Family Cellulases catalytic domain 0.0000000303
Further Details:      
 
Domain Number 2 Region: 732-880
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 9.42e-43
Family Cellulose-binding domain family III 0.00015
Further Details:      
 
Domain Number 3 Region: 560-714
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 2.04e-36
Family Cellulose-binding domain family III 0.0003
Further Details:      
 
Domain Number 4 Region: 884-948
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000000353
Family Type I dockerin domain 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|220929070|ref|YP_002505979.1|
Sequence length 949
Comment glycoside hydrolase [Clostridium cellulolyticum H10]
Sequence
MSKVQKERKKRLSVLLIIAFIAGQIMSAFTVSAEAPPSSFTPAEGWENFNYFNFAEALQK
SLYFYDAEKCGEEAGYDKGGRLEWRGSCHEGDAKIPLKNTNLSAAFIEKYKSILDPDGDG
TVDVHGGFHDAGDHVRFGLPQSYTAGTLGWGFYEFRDSYKAIGEEQHIIDILKYFTDTFL
RCSYLDKDGNLIAFCYMVGEGDVDHCYWGPPELYPEEYQKSRPADFATAETPGSDVCAST
AAALCTSYLNFKDSDPQYAEECLKVAKALYEFAKKYRGKAAGDGYYTSDYDEDELAWAAV
WLYQCTGNMDYIKDIDSVDAQGNYTGYMKRIIPETYNTNTWYNSWTHCWDAVWGGTFLKL
NELLPENELFNFIASWNVEYLSGGVAKHTDPNDHNYYKTSPAGYTMINGWGSARYNTAAQ
LCALVYMKHHPERTDFGEWAKSQMEYIMGRNPMGYSYIVGYGYEQGLPSARHPHHRAAHG
SKTNSMNDPEEHRHILWGALSGGPDASDYHIDSTTEYAYNEVAVDYNAAFVGACAGLFNY
YGQGQEPIADFPPKEPRADDYYCEARVARETADSTQVVLRIHNESCQPPHYETGMKARYF
FNIDELLKSGQGIDDVIFAVEYDEQISMQQEPIKYTGPFKWDEAGTYYYEFDWSGSKIYG
DRELQISFRAKQDSNYLTHWDSSNDYSMKNLTSTYAVTKNVPVYLDGTLVYGEEAPKLDP
STEPENPDNTPPSISVSYKSGTSDGTKNTIRSSINIKNTGTVPINLSDIKVKYWFTNDGN
QQNSFTCEYAALGTGNVIGNFSNISNPVPGADTYCEIGFTSEAGKLAPGGSTGAIPFRIE
GASPYDQSNDYSYNSKMAELGDNTKITGYIKGELKYGVEPVVISINLGDVDGSGTVDAID
FALMKKYLLGALELDSESCVRADVNKDESVNAIDLALLKKYLLGAISTF
Download sequence
Identical sequences B8I2K6
gi|220929070|ref|YP_002505979.1| WP_015925115.1.84728 394503.Ccel_1648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]