SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220929078|ref|YP_002505987.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220929078|ref|YP_002505987.1|
Domain Number 1 Region: 757-881
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.4e-39
Family Family 6 carbohydrate binding module, CBM6 0.00019
Further Details:      
 
Domain Number 2 Region: 32-132,253-276,309-561
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.2e-23
Family Pectate transeliminase 0.015
Further Details:      
 
Domain Number 3 Region: 886-949
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000000795
Family Type I dockerin domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|220929078|ref|YP_002505987.1|
Sequence length 951
Comment family 6 carbohydrate binding protein [Clostridium cellulolyticum H10]
Sequence
MQKNKVSKKFISLILSLVIVLCSIFTFTVSPMVVTAATQAAYYVSPTGSDGNPGTIDAPF
QTITKARDVVRTVNKNMTGDIYVYLRGGDYRLTSTINFGPEDSGTNGFRIFYQAYQDEIP
VLNGATKVTGWTQHNGNIYKATLNRNTKLRYLFVNDKRAQMTKKTVKGQGGYGTYAVTKG
QASWAWTSGSNSDGVKYNASDVPEITSNKDDLEIVNGTTWNENIVCTRDVITSGSSRVLL
LQQPYGAIAQLPGWGAAFTTTSTHTIYNAFEFLNSPGQFYFNKTTKTLYYYPRPGEDMST
ADVEAPVLEKLIDISGKSNTNRVKNITFQGITFANTDWNLIKVGDSYGRTTCQSADGFIA
YYNGNWHDTKYTLLDTYPGMINVSSSDSINFTGNIIKHSAADGITMVNDVINSNLVGNYI
YDITSSGITVGHPQHVYLGDGGEHQKYAPGVEGICTNVVINNNMLWDCSTAPGFGGCAGI
TAFFVNKLKVTYNTVHTTGYNGITLGWGWCNFLDSNTCKDNVINNNRIYNALNRLHDSGA
IYTIGQMPYTTINENYVKGIPDNSTGPTYGLHNDEGSAFITENDNVLDISPGVTYTINCE
DFGQKHDLTILRTYATVNKMGKNPPKSTIDTPVAVPDNVWPLAQYNIALNAGVQEAYRSI
LPSNLFPVQDYVFPASCATKCGADLNIRSSGNAANTVWFAPAGTTKFVVGPTMTKAVGTA
TSIVTPETAGTYKLFVVNSSGAKIGESDALLRVSGSASQIEAESFSSQSGVQTENCSEGG
QDVGYIENGDYTVYNNFDFKNGVTGFKARVASGASGGNIEIRLDSITGPLVGTCPVTSTG
GWQTWADATCNVSGVSGIHNLYLKFTGGSGYLFNINWFEFTGGGTTPVLTGDVNGDDSVD
ATDYAMMKKYLLGLINDFPVEDDLKAGDINKDGVIDAIDLALLKKNLLSGT
Download sequence
Identical sequences B8I2L4
gi|220929078|ref|YP_002505987.1| 394503.Ccel_1656 WP_015925123.1.84728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]