SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220929092|ref|YP_002506001.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220929092|ref|YP_002506001.1|
Domain Number 1 Region: 280-592
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.53e-82
Family beta-glycanases 0.000000294
Further Details:      
 
Domain Number 2 Region: 1-191
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.05e-49
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.00011
Further Details:      
 
Domain Number 3 Region: 193-279
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 3.74e-16
Family beta-Galactosidase/glucuronidase domain 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|220929092|ref|YP_002506001.1|
Sequence length 598
Comment glycoside hydrolase [Clostridium cellulolyticum H10]
Sequence
MLYPVLNSSRTLIDLSGIWSFKADDGTGFQQQWYANKLKNPMTMAVPASYNDQKESIDLR
DHYGYVFYQREIAIPKTLEGQRIVLRFGAVTHYAKVYLNGQLITEHKGGFLPFEVEIQDK
VKSQNNLLTVAVNNVVDYSTLPVGSEVGGNMLGGVLPPVPGVTPKKQNAPNFDFFNYAGI
HRPVKIYSTPKKFIEDITIVPSLEGTKASVYYKIDTIGQGETTLTIYDEEREVVAEAKGN
EGTFIIENVHLWQPLNAYLYAAEITFGEDRYEQSFGVRTVEVKDSQFLINGKPFYFKGFG
KHEDFIAHGRGLDEVLNVKDLSLLRWIGANSFRTSHYPYSEEMMNLCDREGFVVIDETPA
VGVNVNFGAMSGGGKRDTFEVLHTHQHHHDVVVDMIERDKNHPCIVMWSIANESDTTAFP
ESSYNYYKPLYDLAHKVDPQNRPVTIVGVQGEYKTDKTLPAMDVICLNRYYGWYIYGGDL
NAAKQALSIELDYWKTIGKPIIFTEYGADTVAGLHLATPTMFTEEYQVEFLRANHEIFDK
YDCFVGEHVWNFADFQTIQGIMRVEGNKKGAFTRDRRPKLAAHYLQNRWTQIPDFEYK
Download sequence
Identical sequences B8I2M8
394503.Ccel_1670 WP_015925136.1.84728 gi|220929092|ref|YP_002506001.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]