SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220929157|ref|YP_002506066.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|220929157|ref|YP_002506066.1|
Domain Number - Region: 89-125
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 0.0759
Family N-utilization substance G protein NusG, N-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|220929157|ref|YP_002506066.1|
Sequence length 214
Comment hypothetical protein Ccel_1735 [Clostridium cellulolyticum H10]
Sequence
MIQIDDAGSGSFVGGTCIGFYRPETNEYYFDIIPVELYNTDNFKKKLYLEDVVEIAKKAF
IALRVSKSESIEICRGYMFERLKSWLTDEGFCWYVTQITGRIQEVVEKNFELYAINLGLP
NDYIKFTRFPFHFHKLLRWVLSDYENRINLCKVGWKSWQNLKNVTPTLSFTQIHQSNLIC
LKCGKHIKKGSDVAVLEFYSNKQNFVYLHRGCKT
Download sequence
Identical sequences B8I2U3
WP_015925201.1.84728 gi|220929157|ref|YP_002506066.1| 394503.Ccel_1735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]