SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220929224|ref|YP_002506133.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220929224|ref|YP_002506133.1|
Domain Number 1 Region: 6-188
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 4.71e-45
Family HD domain 0.00000213
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|220929224|ref|YP_002506133.1|
Sequence length 196
Comment metal dependent phosphohydrolase [Clostridium cellulolyticum H10]
Sequence
MSDNSFHFFAFLSRMKYINRWGLMRNTYTENIQEHSLQVAIIAHGLAVIRNTYFNGEVNP
ERVAILAMFHDCNEIITGDMPTPIKYYNPQISKIYKDIEDISKEKIISMLPEEMADEYYS
LFFKNPDDTSCWRLVKAADRISAYIKCIEEVKAGNNEFKKAQETILQTIMEINLPEVRYF
MEKFIPSFNLSLDEID
Download sequence
Identical sequences B8I310
gi|220929224|ref|YP_002506133.1| WP_015925268.1.84728 394503.Ccel_1803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]