SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220929575|ref|YP_002506484.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220929575|ref|YP_002506484.1|
Domain Number 1 Region: 219-435
Classification Level Classification E-value
Superfamily SGNH hydrolase 1.83e-23
Family BT2961-like 0.079
Further Details:      
 
Domain Number 2 Region: 40-104
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000000458
Family Type I dockerin domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|220929575|ref|YP_002506484.1|
Sequence length 436
Comment G-D-S-L family lipolytic protein [Clostridium cellulolyticum H10]
Sequence
MRKITIKRKSGAFLIIFSLLFVLFLSSVGSINVSALEPPRLYGDCNGDNNVDALDFVAFK
QYIMEQNHAYDLYKDLNSDNTVDAVDFAILKQFLLGIVKSLPINSAPTQPGVLLVGRFDT
GDPAGPKFGWSTSTIKANFKGTGISANLNSMGDNWFNVVIDGVVKSPVNVPSGSSGPVTL
ATDLTNGNHTIELVRRTEAWIGEVQFLGFNVTDGSLLAPPAPSNRRIEFIGDSITCGYGN
EGTSQYQSFTNKNENAYLAYGATTARLLNADPITVCWSGKGLVQNYGGDLNDLMPAVYSR
ILPYNSTLTWDTSKWIPQVVVINLGTNDFSTGSIDKTTFAKAYTNFVTKIRGQYPDAHIY
CAVGPMLSWDQLAKCKDAITSVVDQKNTSGDSKIHFIEFPVQVEANGYGEDWHPSVKTHE
LMANQLAATIKTDLGW
Download sequence
Identical sequences B8I471
gi|220929575|ref|YP_002506484.1| 394503.Ccel_2162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]