SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220929639|ref|YP_002506548.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220929639|ref|YP_002506548.1|
Domain Number 1 Region: 141-586
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 5.95e-116
Family Cellulases catalytic domain 0.000000166
Further Details:      
 
Domain Number 2 Region: 52-139
Classification Level Classification E-value
Superfamily E set domains 1.54e-20
Family E-set domains of sugar-utilizing enzymes 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|220929639|ref|YP_002506548.1|
Sequence length 591
Comment glycoside hydrolase [Clostridium cellulolyticum H10]
Sequence
MNWKNTIISLTLAGSFIFTMSSCTSKPVSSNVPEVTNQAVTSMSQDLKAENEISDDVHVN
QLGYKTLSKKIAVIKGQYKKFQVVDSKTGVAVLTGDLTGNPKDESSGDTVCYADFSKITV
PGKYFISISGLGKSYDFLIDDNVYSKLGDAMLKALCYQRCGTALTPDFAGEYSHAECHKT
LAKFYNDETREIDVSGGWHDAGDYGRYVVPATVTVAGLLLAYEFYPQVFTDAVRIPESGN
KIPDVLDEAKYGIEWLLKMQDSESGGVYHKVTSRVFPEMTTMPDKDVDNQLVMSISTNAT
ADFAAVTAMASRIYVTIDPVFSQNCLQASQKAWEWLEKNKDFVSFKNPSDVASGEYGDSS
GKDEKAWAAAELFRATGNEKYNEYFTDNYQIEGFGLGWQNVSGFAAIAYMFSDVSGTDQK
KVDEIKKAWLDKADMFASTGQKDGYLVAMHKMEYNWGSNMNVATHAMHLLISDRLKTDDK
YIHTAEDCTHYLLGRNTLNQSYITGFGSKQVKKPHHRPSAADLALNPVPGLMVGGPDSAL
EDDVAKSKLSGKFPAECYIDDINSFSTNEVATYWNSPVIFILGYLNSNRLL
Download sequence
Identical sequences B8I4R4
394503.Ccel_2226 gi|220929639|ref|YP_002506548.1| WP_015925661.1.84728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]