SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220929656|ref|YP_002506565.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220929656|ref|YP_002506565.1|
Domain Number 1 Region: 37-360
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.47e-78
Family Pectate lyase-like 0.00031
Further Details:      
 
Domain Number 2 Region: 384-450
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000000005
Family Type I dockerin domain 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|220929656|ref|YP_002506565.1|
Sequence length 462
Comment Pectate lyase/Amb allergen [Clostridium cellulolyticum H10]
Sequence
MLRKMRIFLLAGAVMMQSLIGFGAVDTAHAAVNGLFGLVGFATMNGGTTGGAGGKEVTVK
SAAEMSELLNQRKKNDDTSPLIIKVASKLTGTGAIGVKEVSNVSIIGVGSSGELDGVGLN
IVKASNIIVQNLKIHHTLAPTDCIGIENSKNVWIDHCELYNMIGDCNGDGKVDEKGDISG
GDVDWYDGLLDCKKDSAYITVSWNYFHDSFKTSLVGSSDSDNYDRKMTYHHNVFKNLKER
LPSYRFGTGHIFSNYYADVWNSAVNSRMGAQLKVESNYFERVGSGAVNGESGLAAGPIGS
YNSDLIGYYDVKDNTYVSCKGNQPTTSTCNYTPPYEYTGYLTPASRVKELVTQYAGVGKL
DGSNPTNPTDPTEPTDPQDPIETTKCGDINGDGSIDTIDFATLKIYLLGQSITIKTEASD
LDSDKAVTILDLAVLKKYLLGQVTTLPVNNGITDPGGNTNPI
Download sequence
Identical sequences B8I4T1
394503.Ccel_2243 gi|220929656|ref|YP_002506565.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]