SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220929726|ref|YP_002506635.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220929726|ref|YP_002506635.1|
Domain Number 1 Region: 517-864
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.97e-86
Family beta-glycanases 0.00000355
Further Details:      
 
Domain Number 2 Region: 884-1064
Classification Level Classification E-value
Superfamily CBD9-like 6.67e-50
Family Family 9 carbohydrate-binding module, CBD9 0.00000754
Further Details:      
 
Domain Number 3 Region: 358-508
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.32e-28
Family CBM22 0.018
Further Details:      
 
Domain Number 4 Region: 34-188
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.14e-24
Family CBM22 0.076
Further Details:      
 
Domain Number 5 Region: 197-353
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.06e-23
Family CBM22 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|220929726|ref|YP_002506635.1|
Sequence length 1495
Comment glycoside hydrolase [Clostridium cellulolyticum H10]
Sequence
MRRNVKWNRVLSVVMTIALLFSVMPLNNVVKAEVETIYHEDFAKGKGAALQAGDATLTTV
TDKVFVGNDDGAALYVNPRKNNWDGADFSFDKLGMKEGVKYTITVKGYVDPETDPENPVV
LSGSQAFLQVVDSYAWIAGADFVAGEEFTLTGTYTVDTSKDSAIRIQSNDVGATVPFYIG
EITVTGEKLTAPTPVTEKTIYHETFESGNGLAKQSGDATLTTVTEKTFPTGDVEGTVLNE
DGAALYVDTRVNNYDGADFVFSDIGLENGKSYEITVIGYVDSITDVPAGAQAFLQSISSY
GVVASTDFVAGKPFILKGKYTVDTSKDDRIRVQSNDEGAAVPFYIGDILITGPAPSMKTI
DFEDGTEGGFIPRIGKEVLSVTNEANHTDGGEYALKVDGGRENAYCGPSLRIEKYIDQGS
EYRVTVWVKLASDAESAEIDLSTQIGNGEGVAEYPSLSKKTVKKSDGWVKFEGKQRYYDT
SSGYITIYLQSDNTAAAFYIDDVSVVNSGSVSLPIQTDLTPIKDVYKDDFLFGNAIAPNE
LKGKSFELLKHHFNVITAGNDMKPDALQRSKGVFSFETADAMIQKAHDNNIQVHGHVLVW
HQQTPVWMNGVTDDADVTKYKKDENGKNITIPREEALINMRTHIENVVKHFGDKVISWDV
VNEAMSDGISDPSDWKNCLRKDSMWYQSIGDDYVEQAFLITKEVLEKNNLNDIKLYYNDY
NDDDQNKSQAIANMVNEINTNYAKTHPDKLLIDGVGMQAHYSTSTKPKNVEASLKRFIDL
GVDVCVTELDITAGSGQKQSSDEINAQAYLYAQLMKIYKAHADNISRITIWGLDDGSSWR
KEACPLPFDSDLQAKNAYYAIIDPDKYMAEHEAPPTVEIKQGTAAKGTPVIDGTVDSIWD
KAKVIPIDKANAAWETAKGTAQVLWDDKNLYVLIKVNDSVLDKSSANPWEHDSVEAFVDE
NNGKTESYENDDGQYRVNYDNETSFNPDKIKEGFESAVKVSGTSYTVEMKIPFKTVTPTN
NLKIGFDAQINDAKDGTRTGYRNWNDTTGVGYKDTTVYGELILIDGSTPIPSSPSNDKTS
SEKVKGTVNGKEVPIAKAAIEYKDGKKVTSIVVDDTKVSELLGQKSVVVLEPSTKSDVVI
GQLNAQTIKNMADKEAILEIKTENISYTMPASKINIEKVASALGNNIDLTDIKVNVSISG
VSDSVNNIVKDSAEKNNYKLASTPVEFNLTCSNGTKTVEISKFNGYIERTIAIPDGVNPN
GVITAIVLNKDGSFSHIPTAIVLKDGKYYAKINSLTNSTYALISNTKTFKDVENHWSKNA
VKNIASRLIMNGADNDSFVPDMAITRGEFIESIVKAIGLYRTDEGKDIFADVSSSNSYYD
AVSIASEYGIISGYGNGEFRPMSTITRQEAMTIVAKTMKITGLKVDYTTDEIADSLIGFK
DSDKLAVWARNSTAACVKAGIVAGKSLTVIAPEDNITRAETASVINKLLINSNLI
Download sequence
Identical sequences B8I5B9
gi|220929726|ref|YP_002506635.1| 394503.Ccel_2319 WP_015925747.1.84728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]