SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220929727|ref|YP_002506636.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220929727|ref|YP_002506636.1|
Domain Number 1 Region: 357-692
Classification Level Classification E-value
Superfamily (Trans)glycosidases 9.67e-93
Family beta-glycanases 0.00000123
Further Details:      
 
Domain Number 2 Region: 710-892
Classification Level Classification E-value
Superfamily CBD9-like 4.32e-53
Family Family 9 carbohydrate-binding module, CBD9 0.00000574
Further Details:      
 
Domain Number 3 Region: 193-346
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.97e-32
Family CBM22 0.013
Further Details:      
 
Domain Number 4 Region: 31-179
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.13e-27
Family CBM22 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|220929727|ref|YP_002506636.1|
Sequence length 1050
Comment glycoside hydrolase [Clostridium cellulolyticum H10]
Sequence
MYRNRNKVLALLLAFAMIISVMPMSAVMAETKTTYHETFADGKGAATQSGGATLEKVGNK
VFEGNDDGAALYVSNRKNNWDAADFKFNDIGLKNGKTYSITVKGFVDSNAKVPAGAQAFL
QVVNSYAWLAGSDFVAGKAFTLSGKYTVDTSKDDGIRVQSNDEGKEVPFYIGDISITEEA
VEEVPEDPSRPKAETFKTITFEDKTTGGFGARSGEGGEKLTVTKEANHTDGGSYALKVEN
RTMTWHGPSMNVEKFVSQGSEYKVTAWVKLASPESSQLQLSTQVGNGGTASYVSLAAKTI
STSDGWVKYEGTYRYNNVSSEYITIYVESASSANASFYIDDISFEQTGSGPIKIQNDLES
IKNVYKKDFLIGNAIAAEDMEGVRLDLLKKHFNVMTAGNAMKPDALQPTKGNFTFADADK
LVDKVLAEGFEMHGHTLVWHQQSPAWLNTKVDASGNAVPLSREEALTNLKTHIKTVVEHY
GNKVISWDVVNEGMNDNPSNPEDWRGALRQSPWYQAIGPDYMEQAFLAAREVLDAHPDWD
VKLYYNDYNDDNQNKSKAIYYMVKELNEKYAKTHPGKLLIDGVGMQAHYNMSTNPSNVEL
SLERFISLGVEVSITELDVQAGSDFKLTDEIANAQGYLYAQLFDIYKKHAANISRITIWG
LDDGTSWRSSTNPLPFDKNLQAKPAFFGTVDPAKFMNEHQPQTPKNAKYTTARYGTPVID
GTVDSVWSKAQDIPINQYQMAWQGATGTAKALWDDKNLYVLVQVSDSELDKKSVNTYEQD
SVEVFIDENNGKTTFYQDDDGQYRVNYDNETSFNPESISTGFKSATKVSGTSYTVEIKIP
LKSVTPSNNLKIGFDVQINDAKDGSRKSVATWNDTTGNGYQDTSVYGVLTLSNSDSNNTS
QYITRGEFIDSIIKALGLNKNVQVKDSFKDVTKDSSYYASVSVAYQKGIVSGYKNGEFKP
QAKITRQEAMTIIAKAMKAAGKNVNYSADEINKILKEFKDSNKVAGWAKGSVAACIKAGI
VSGKSGKMLAPQENITFSQTESIVKKLSAK
Download sequence
Identical sequences B8I5C0
394503.Ccel_2320 WP_015925748.1.84728 gi|220929727|ref|YP_002506636.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]